Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N7B5Z4

Protein Details
Accession A0A5N7B5Z4   
Localization Confidence Low
Confidence Score 5.3
NoLS Segment(s)
PositionSequenceProtein Nature
358-380VWKSIYHDFRRRRKDICKLLSYPHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 15, mito 6, nucl 1, cyto 1, cyto_nucl 1, pero 1, E.R. 1, golg 1, vacu 1, cyto_pero 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR029044  Nucleotide-diphossugar_trans  
Gene Ontology GO:0016020  C:membrane  
GO:0016740  F:transferase activity  
GO:0048856  P:anatomical structure development  
GO:0043934  P:sporulation  
Amino Acid Sequences MAIKKVPRLPHRRGSQSSEDDFFDIPDEPCLAIARRQLRRIRTWIVFAFIVLFIVWFRRERPEPPALPHINYDLVDWSRYAYSQYATSSAYLCNAVMVFEALQRLGSRAQRVLFFPEDWDVSVNSERDRDSQLLAMARDKYNVMLVPISLEVIKPGAGPGEPWDKSISKLLAFGESEYDRIIHLDSDANVLQSMDELFFLPPTKVAMPRAYWGLPDTKQLSSLLIVIEPSYREYNALMEAALPAMYGQKTVNTSSTNRYDMELLNERYADSATVLPHRQYGLVSGEFRNKDHRNFLGNDYETWDPDKVLSEAKLVHFSDWPLPKPWVLWPQTLLAEMLPKCKHNPGTPQESGCRDREVWKSIYHDFRRRRKDICKLLSYPAPDWPPTKQSESSGTNEFV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.77
3 0.76
4 0.72
5 0.65
6 0.57
7 0.49
8 0.43
9 0.35
10 0.27
11 0.21
12 0.17
13 0.16
14 0.15
15 0.13
16 0.13
17 0.16
18 0.16
19 0.17
20 0.24
21 0.32
22 0.37
23 0.46
24 0.52
25 0.57
26 0.63
27 0.67
28 0.68
29 0.62
30 0.62
31 0.56
32 0.53
33 0.45
34 0.37
35 0.31
36 0.23
37 0.19
38 0.12
39 0.11
40 0.07
41 0.09
42 0.11
43 0.11
44 0.13
45 0.2
46 0.24
47 0.27
48 0.34
49 0.42
50 0.44
51 0.48
52 0.57
53 0.52
54 0.5
55 0.49
56 0.44
57 0.37
58 0.34
59 0.29
60 0.23
61 0.21
62 0.19
63 0.18
64 0.17
65 0.14
66 0.14
67 0.15
68 0.12
69 0.12
70 0.14
71 0.15
72 0.15
73 0.16
74 0.16
75 0.16
76 0.14
77 0.14
78 0.13
79 0.11
80 0.1
81 0.09
82 0.08
83 0.07
84 0.07
85 0.06
86 0.07
87 0.08
88 0.07
89 0.08
90 0.08
91 0.09
92 0.13
93 0.15
94 0.17
95 0.2
96 0.22
97 0.23
98 0.25
99 0.28
100 0.27
101 0.24
102 0.22
103 0.21
104 0.2
105 0.18
106 0.18
107 0.13
108 0.13
109 0.16
110 0.15
111 0.14
112 0.15
113 0.16
114 0.17
115 0.2
116 0.18
117 0.16
118 0.17
119 0.18
120 0.19
121 0.19
122 0.2
123 0.2
124 0.19
125 0.19
126 0.17
127 0.15
128 0.14
129 0.14
130 0.12
131 0.09
132 0.08
133 0.09
134 0.08
135 0.08
136 0.07
137 0.06
138 0.06
139 0.06
140 0.06
141 0.05
142 0.05
143 0.05
144 0.05
145 0.05
146 0.08
147 0.15
148 0.15
149 0.17
150 0.19
151 0.19
152 0.21
153 0.24
154 0.22
155 0.15
156 0.17
157 0.16
158 0.16
159 0.15
160 0.14
161 0.14
162 0.12
163 0.12
164 0.11
165 0.1
166 0.08
167 0.08
168 0.08
169 0.05
170 0.06
171 0.07
172 0.07
173 0.09
174 0.09
175 0.09
176 0.09
177 0.08
178 0.07
179 0.06
180 0.06
181 0.04
182 0.04
183 0.05
184 0.05
185 0.05
186 0.06
187 0.06
188 0.06
189 0.07
190 0.08
191 0.09
192 0.11
193 0.13
194 0.13
195 0.15
196 0.17
197 0.16
198 0.15
199 0.15
200 0.16
201 0.15
202 0.17
203 0.19
204 0.16
205 0.17
206 0.17
207 0.17
208 0.13
209 0.13
210 0.1
211 0.07
212 0.07
213 0.06
214 0.07
215 0.07
216 0.08
217 0.08
218 0.08
219 0.08
220 0.09
221 0.09
222 0.09
223 0.09
224 0.07
225 0.06
226 0.06
227 0.06
228 0.05
229 0.04
230 0.03
231 0.05
232 0.05
233 0.06
234 0.06
235 0.08
236 0.1
237 0.11
238 0.13
239 0.14
240 0.16
241 0.21
242 0.25
243 0.25
244 0.24
245 0.24
246 0.24
247 0.22
248 0.26
249 0.27
250 0.25
251 0.24
252 0.24
253 0.23
254 0.21
255 0.21
256 0.15
257 0.09
258 0.09
259 0.09
260 0.13
261 0.15
262 0.15
263 0.16
264 0.16
265 0.15
266 0.14
267 0.15
268 0.15
269 0.17
270 0.19
271 0.19
272 0.26
273 0.27
274 0.27
275 0.34
276 0.34
277 0.35
278 0.38
279 0.4
280 0.39
281 0.41
282 0.44
283 0.44
284 0.41
285 0.37
286 0.35
287 0.32
288 0.27
289 0.27
290 0.23
291 0.15
292 0.14
293 0.16
294 0.13
295 0.15
296 0.15
297 0.15
298 0.17
299 0.18
300 0.24
301 0.22
302 0.22
303 0.21
304 0.22
305 0.28
306 0.3
307 0.31
308 0.28
309 0.29
310 0.29
311 0.29
312 0.34
313 0.35
314 0.34
315 0.34
316 0.33
317 0.35
318 0.35
319 0.34
320 0.28
321 0.19
322 0.22
323 0.2
324 0.25
325 0.24
326 0.25
327 0.27
328 0.34
329 0.39
330 0.39
331 0.49
332 0.49
333 0.57
334 0.59
335 0.61
336 0.6
337 0.61
338 0.59
339 0.51
340 0.48
341 0.41
342 0.43
343 0.45
344 0.45
345 0.41
346 0.41
347 0.44
348 0.46
349 0.55
350 0.57
351 0.6
352 0.65
353 0.72
354 0.78
355 0.79
356 0.8
357 0.79
358 0.81
359 0.83
360 0.82
361 0.81
362 0.74
363 0.75
364 0.72
365 0.67
366 0.58
367 0.54
368 0.49
369 0.43
370 0.42
371 0.41
372 0.41
373 0.42
374 0.46
375 0.41
376 0.41
377 0.46
378 0.49
379 0.48