Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N7B743

Protein Details
Accession A0A5N7B743    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
40-62MDSHIRQRRIKIKPNQTDKERERBasic
NLS Segment(s)
Subcellular Location(s) extr 11, E.R. 5, mito 4, plas 4, pero 2, mito_nucl 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MLKITNHAVSNAPANGNGYVIDSMVLIVGGFDFVLGFGWMDSHIRQRRIKIKPNQTDKERERALFRPTRMALVV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.17
3 0.16
4 0.14
5 0.11
6 0.09
7 0.09
8 0.08
9 0.06
10 0.06
11 0.05
12 0.05
13 0.03
14 0.03
15 0.03
16 0.02
17 0.02
18 0.02
19 0.02
20 0.02
21 0.02
22 0.03
23 0.03
24 0.02
25 0.03
26 0.03
27 0.04
28 0.05
29 0.14
30 0.18
31 0.24
32 0.27
33 0.34
34 0.43
35 0.51
36 0.6
37 0.62
38 0.68
39 0.73
40 0.81
41 0.82
42 0.79
43 0.81
44 0.75
45 0.74
46 0.68
47 0.61
48 0.56
49 0.53
50 0.56
51 0.53
52 0.51
53 0.51
54 0.47