Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N7ANL6

Protein Details
Accession A0A5N7ANL6    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MLLANRPRKKKKSGDSEGRIWLHydrophilic
NLS Segment(s)
PositionSequence
6-12RPRKKKK
Subcellular Location(s) nucl 15.5, mito 10, cyto_nucl 9
Family & Domain DBs
Amino Acid Sequences MLLANRPRKKKKSGDSEGRIWLQTGKIRVNIGNPGGGKDDAIDIWTGFLNREENPGILHHTPSSKENGLLHRRTI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.82
3 0.81
4 0.77
5 0.69
6 0.59
7 0.48
8 0.39
9 0.31
10 0.28
11 0.25
12 0.21
13 0.21
14 0.22
15 0.23
16 0.23
17 0.23
18 0.2
19 0.2
20 0.18
21 0.16
22 0.17
23 0.16
24 0.14
25 0.1
26 0.1
27 0.07
28 0.07
29 0.06
30 0.04
31 0.05
32 0.06
33 0.06
34 0.06
35 0.07
36 0.08
37 0.08
38 0.12
39 0.12
40 0.12
41 0.13
42 0.14
43 0.18
44 0.17
45 0.19
46 0.18
47 0.19
48 0.21
49 0.23
50 0.28
51 0.24
52 0.26
53 0.3
54 0.37
55 0.44