Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C5M3B3

Protein Details
Accession C5M3B3    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
76-122DYACEMDRRRNNRRERKRETKSYTVDNQIKNQTKKSEREREREREDEHydrophilic
NLS Segment(s)
PositionSequence
84-93RRNNRRERKR
Subcellular Location(s) nucl 21, cyto_nucl 12, mito 5
Family & Domain DBs
KEGG ctp:CTRG_00552  -  
Amino Acid Sequences MMNIRNIYDLTVYLIVYERVCKLSRLVRRYSRASFTLSLVMPTITRRRQGVLVVVSMLDSKNERNENFLSYLQFLDYACEMDRRRNNRRERKRETKSYTVDNQIKNQTKKSEREREREREDEVKEEEKKINHEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.13
3 0.13
4 0.14
5 0.12
6 0.15
7 0.16
8 0.16
9 0.19
10 0.27
11 0.35
12 0.38
13 0.45
14 0.51
15 0.56
16 0.62
17 0.62
18 0.59
19 0.53
20 0.51
21 0.44
22 0.37
23 0.35
24 0.29
25 0.24
26 0.2
27 0.18
28 0.13
29 0.15
30 0.2
31 0.18
32 0.21
33 0.21
34 0.22
35 0.24
36 0.25
37 0.27
38 0.22
39 0.19
40 0.17
41 0.16
42 0.14
43 0.13
44 0.11
45 0.07
46 0.06
47 0.06
48 0.11
49 0.14
50 0.14
51 0.17
52 0.18
53 0.19
54 0.21
55 0.21
56 0.17
57 0.15
58 0.15
59 0.12
60 0.11
61 0.09
62 0.08
63 0.07
64 0.07
65 0.07
66 0.11
67 0.12
68 0.19
69 0.26
70 0.33
71 0.42
72 0.5
73 0.6
74 0.67
75 0.78
76 0.81
77 0.84
78 0.88
79 0.88
80 0.9
81 0.87
82 0.85
83 0.79
84 0.75
85 0.71
86 0.69
87 0.67
88 0.59
89 0.57
90 0.57
91 0.62
92 0.58
93 0.57
94 0.57
95 0.57
96 0.63
97 0.68
98 0.69
99 0.69
100 0.76
101 0.8
102 0.81
103 0.82
104 0.77
105 0.73
106 0.69
107 0.64
108 0.59
109 0.55
110 0.53
111 0.48
112 0.48
113 0.47
114 0.43