Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N7AWJ0

Protein Details
Accession A0A5N7AWJ0    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
75-106EVIPVKEKVKVKKKRKIKKEIKDKIKEERMPTBasic
NLS Segment(s)
PositionSequence
80-101KEKVKVKKKRKIKKEIKDKIKE
Subcellular Location(s) nucl 13, mito 13, mito_nucl 13
Family & Domain DBs
Amino Acid Sequences MSESIRQLYNPQRHNIYLLATNIKGKSPIYLSPIVDTRQAVEDLLSKWFESRTTVGEKEYMVHLVIERTNTPDEEVIPVKEKVKVKKKRKIKKEIKDKIKEERMPTPIS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.44
3 0.37
4 0.33
5 0.3
6 0.29
7 0.25
8 0.27
9 0.25
10 0.25
11 0.23
12 0.19
13 0.19
14 0.17
15 0.19
16 0.21
17 0.24
18 0.24
19 0.25
20 0.27
21 0.26
22 0.24
23 0.22
24 0.18
25 0.16
26 0.15
27 0.13
28 0.11
29 0.12
30 0.11
31 0.13
32 0.12
33 0.1
34 0.1
35 0.1
36 0.1
37 0.1
38 0.1
39 0.11
40 0.15
41 0.16
42 0.16
43 0.16
44 0.16
45 0.15
46 0.14
47 0.12
48 0.08
49 0.08
50 0.07
51 0.08
52 0.09
53 0.09
54 0.09
55 0.11
56 0.12
57 0.12
58 0.12
59 0.12
60 0.11
61 0.14
62 0.15
63 0.14
64 0.16
65 0.18
66 0.18
67 0.23
68 0.28
69 0.34
70 0.43
71 0.53
72 0.6
73 0.68
74 0.78
75 0.83
76 0.89
77 0.9
78 0.91
79 0.91
80 0.92
81 0.93
82 0.93
83 0.93
84 0.88
85 0.87
86 0.87
87 0.82
88 0.76
89 0.74