Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N7BL83

Protein Details
Accession A0A5N7BL83    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
29-48RVRMHPRRYVQKRTNRYHPGBasic
NLS Segment(s)
Subcellular Location(s) plas 9, mito 8, E.R. 5, extr 4, cyto_mito 4, mito_nucl 4
Family & Domain DBs
Amino Acid Sequences MFVFMLLYFIFIFFSTSCCPPLSIHVHVRVRMHPRRYVQKRTNRYHPGQLVLLPGLGIFQYSEFERPDPRFHSKPNQILLSESRVELAVPFFFFDF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.13
3 0.14
4 0.16
5 0.16
6 0.17
7 0.16
8 0.23
9 0.25
10 0.28
11 0.32
12 0.39
13 0.41
14 0.43
15 0.45
16 0.44
17 0.48
18 0.49
19 0.49
20 0.46
21 0.49
22 0.58
23 0.63
24 0.68
25 0.67
26 0.7
27 0.76
28 0.76
29 0.8
30 0.77
31 0.72
32 0.69
33 0.62
34 0.54
35 0.45
36 0.39
37 0.3
38 0.22
39 0.18
40 0.1
41 0.08
42 0.06
43 0.05
44 0.04
45 0.03
46 0.03
47 0.04
48 0.05
49 0.07
50 0.08
51 0.1
52 0.15
53 0.17
54 0.22
55 0.26
56 0.33
57 0.35
58 0.4
59 0.49
60 0.53
61 0.58
62 0.6
63 0.58
64 0.5
65 0.5
66 0.48
67 0.43
68 0.35
69 0.29
70 0.23
71 0.19
72 0.19
73 0.16
74 0.15
75 0.12
76 0.11