Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C5MCC4

Protein Details
Accession C5MCC4   
Localization Confidence Medium
Confidence Score 14.9
NoLS Segment(s)
PositionSequenceProtein Nature
69-88QLSKKQLPRQQQQQQQQHASHydrophilic
327-346PRNSLGGKHISKRKVKKKVRBasic
NLS Segment(s)
PositionSequence
333-346GKHISKRKVKKKVR
Subcellular Location(s) nucl 18, cyto_nucl 13.5, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR033882  DDI1_N  
IPR019103  Peptidase_aspartic_DDI1-type  
IPR021109  Peptidase_aspartic_dom_sf  
IPR000626  Ubiquitin-like_dom  
IPR029071  Ubiquitin-like_domsf  
Gene Ontology GO:0005886  C:plasma membrane  
GO:0004190  F:aspartic-type endopeptidase activity  
GO:0031593  F:polyubiquitin modification-dependent protein binding  
GO:1904855  F:proteasome regulatory particle binding  
GO:0030674  F:protein-macromolecule adaptor activity  
GO:0000149  F:SNARE binding  
GO:0043130  F:ubiquitin binding  
GO:0045740  P:positive regulation of DNA replication  
GO:0009306  P:protein secretion  
GO:0043328  P:protein transport to vacuole involved in ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway  
KEGG ctp:CTRG_03716  -  
Pfam View protein in Pfam  
PF09668  Asp_protease  
PF00240  ubiquitin  
PROSITE View protein in PROSITE  
PS50053  UBIQUITIN_2  
CDD cd05479  RP_DDI  
cd01796  Ubl_Ddi1_like  
Amino Acid Sequences MQLTISLDDNNDIISVDVPESLTLEDFKAYLQAETGIEPSDQVLKFNGNELTDNKPLNELQINDNDLLQLSKKQLPRQQQQQQQQHASGSPQTPSNPIDERIEMIRQQILADPTARDQVRLTQPSLYDALNDGSRFRSLMMEQVSEQHNQSASNQAEMLRLQQDPDNPENQARILELIRQEAIEENMKLAWEISPESFTSVNMLYIKLKINGVDRVAMVDSGAAMTTISPSIAEEVGLSRLIDKRFQGQAVGVGTQNIGGKIHSAPIEIGDSKIELPCSFYVVDTSVGILFGLDMLRRHRCTIDLERDVLIIGKHIEAKFLSESEIPRNSLGGKHISKRKVKKKVR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.09
3 0.08
4 0.09
5 0.09
6 0.09
7 0.09
8 0.1
9 0.1
10 0.09
11 0.1
12 0.1
13 0.09
14 0.09
15 0.12
16 0.12
17 0.11
18 0.11
19 0.12
20 0.12
21 0.13
22 0.14
23 0.12
24 0.11
25 0.11
26 0.11
27 0.16
28 0.16
29 0.16
30 0.16
31 0.18
32 0.18
33 0.22
34 0.24
35 0.18
36 0.21
37 0.23
38 0.27
39 0.29
40 0.3
41 0.27
42 0.27
43 0.25
44 0.26
45 0.28
46 0.24
47 0.23
48 0.27
49 0.29
50 0.27
51 0.26
52 0.23
53 0.19
54 0.18
55 0.15
56 0.13
57 0.15
58 0.21
59 0.25
60 0.32
61 0.38
62 0.47
63 0.55
64 0.63
65 0.68
66 0.71
67 0.77
68 0.8
69 0.82
70 0.76
71 0.69
72 0.6
73 0.52
74 0.45
75 0.39
76 0.31
77 0.24
78 0.21
79 0.2
80 0.22
81 0.22
82 0.24
83 0.22
84 0.22
85 0.24
86 0.22
87 0.23
88 0.22
89 0.23
90 0.19
91 0.18
92 0.18
93 0.15
94 0.15
95 0.16
96 0.15
97 0.14
98 0.14
99 0.14
100 0.13
101 0.2
102 0.19
103 0.17
104 0.16
105 0.22
106 0.28
107 0.3
108 0.3
109 0.27
110 0.27
111 0.28
112 0.29
113 0.22
114 0.15
115 0.13
116 0.13
117 0.12
118 0.12
119 0.11
120 0.1
121 0.11
122 0.1
123 0.1
124 0.1
125 0.09
126 0.13
127 0.14
128 0.14
129 0.14
130 0.18
131 0.19
132 0.18
133 0.18
134 0.14
135 0.13
136 0.12
137 0.13
138 0.17
139 0.15
140 0.15
141 0.15
142 0.15
143 0.15
144 0.15
145 0.16
146 0.1
147 0.1
148 0.1
149 0.11
150 0.13
151 0.17
152 0.19
153 0.18
154 0.17
155 0.18
156 0.18
157 0.16
158 0.14
159 0.1
160 0.09
161 0.08
162 0.1
163 0.1
164 0.1
165 0.1
166 0.09
167 0.09
168 0.09
169 0.1
170 0.1
171 0.09
172 0.08
173 0.08
174 0.08
175 0.08
176 0.07
177 0.06
178 0.05
179 0.06
180 0.06
181 0.07
182 0.07
183 0.09
184 0.09
185 0.09
186 0.1
187 0.09
188 0.1
189 0.1
190 0.1
191 0.09
192 0.11
193 0.13
194 0.12
195 0.13
196 0.13
197 0.15
198 0.17
199 0.17
200 0.16
201 0.15
202 0.15
203 0.15
204 0.13
205 0.1
206 0.07
207 0.06
208 0.04
209 0.04
210 0.03
211 0.03
212 0.03
213 0.04
214 0.04
215 0.04
216 0.04
217 0.04
218 0.05
219 0.05
220 0.05
221 0.05
222 0.06
223 0.07
224 0.08
225 0.07
226 0.08
227 0.12
228 0.13
229 0.15
230 0.16
231 0.2
232 0.22
233 0.23
234 0.22
235 0.18
236 0.21
237 0.2
238 0.2
239 0.15
240 0.13
241 0.12
242 0.13
243 0.13
244 0.1
245 0.09
246 0.07
247 0.09
248 0.09
249 0.12
250 0.11
251 0.11
252 0.11
253 0.12
254 0.15
255 0.14
256 0.14
257 0.11
258 0.12
259 0.12
260 0.13
261 0.13
262 0.1
263 0.13
264 0.13
265 0.14
266 0.14
267 0.13
268 0.13
269 0.14
270 0.15
271 0.11
272 0.12
273 0.09
274 0.09
275 0.09
276 0.07
277 0.05
278 0.05
279 0.06
280 0.06
281 0.08
282 0.13
283 0.2
284 0.22
285 0.25
286 0.26
287 0.27
288 0.34
289 0.42
290 0.48
291 0.45
292 0.45
293 0.43
294 0.42
295 0.4
296 0.33
297 0.23
298 0.15
299 0.12
300 0.12
301 0.17
302 0.17
303 0.19
304 0.18
305 0.21
306 0.22
307 0.21
308 0.22
309 0.2
310 0.23
311 0.27
312 0.32
313 0.3
314 0.28
315 0.29
316 0.27
317 0.27
318 0.28
319 0.3
320 0.32
321 0.4
322 0.48
323 0.56
324 0.65
325 0.73
326 0.79