Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N7BJQ7

Protein Details
Accession A0A5N7BJQ7   
Localization Confidence Low
Confidence Score 5.8
NoLS Segment(s)
PositionSequenceProtein Nature
89-115ATRRISKERQPNPTHNTRRNRDRVQRLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 23, nucl 2
Family & Domain DBs
PROSITE View protein in PROSITE  
PS51257  PROKAR_LIPOPROTEIN  
Amino Acid Sequences MKCLRRRPRYYSTLNAIVSCRTRALDIAFISTSDKDKPFTDTVLLYASFKAITKDPCPWTWKYRHLYRPWSVRSPQQALRHAPSPSRIATRRISKERQPNPTHNTRRNRDRVQRL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.58
3 0.49
4 0.44
5 0.39
6 0.31
7 0.25
8 0.18
9 0.17
10 0.17
11 0.18
12 0.19
13 0.18
14 0.19
15 0.18
16 0.18
17 0.19
18 0.18
19 0.17
20 0.15
21 0.16
22 0.15
23 0.16
24 0.2
25 0.2
26 0.2
27 0.2
28 0.17
29 0.17
30 0.17
31 0.16
32 0.12
33 0.11
34 0.1
35 0.08
36 0.08
37 0.09
38 0.09
39 0.12
40 0.13
41 0.19
42 0.21
43 0.24
44 0.27
45 0.29
46 0.33
47 0.36
48 0.42
49 0.43
50 0.49
51 0.55
52 0.58
53 0.62
54 0.63
55 0.66
56 0.63
57 0.62
58 0.56
59 0.53
60 0.53
61 0.51
62 0.52
63 0.5
64 0.51
65 0.5
66 0.52
67 0.51
68 0.45
69 0.42
70 0.38
71 0.34
72 0.31
73 0.34
74 0.32
75 0.33
76 0.39
77 0.47
78 0.53
79 0.58
80 0.61
81 0.63
82 0.71
83 0.75
84 0.78
85 0.76
86 0.76
87 0.75
88 0.8
89 0.82
90 0.8
91 0.82
92 0.81
93 0.84
94 0.85
95 0.87