Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N7BGJ9

Protein Details
Accession A0A5N7BGJ9   
Localization Confidence Medium
Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
52-73GVSKRKSKTKALSKVQRARQQKHydrophilic
NLS Segment(s)
PositionSequence
55-68KRKSKTKALSKVQR
94-100KRGKTVK
Subcellular Location(s) nucl 15.5, mito 10, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR022784  Ribosome_bgen_Alb1  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005634  C:nucleus  
Pfam View protein in Pfam  
PF09135  Alb1  
Amino Acid Sequences MAKARVQSKHSRAARRAASPSLDVDKSLTTLPRAEDTVIQRESILSDRANAGVSKRKSKTKALSKVQRARQQKGIERAENIMDQLEAKVEKSVKRGKTVKARRAEWEDLNRKSGATMFQSLNDEADNDDEDAMADVSAAPKKTKSQSQPAYVAQNPVADQHADIDVDDDIS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.67
3 0.66
4 0.6
5 0.55
6 0.47
7 0.47
8 0.43
9 0.36
10 0.3
11 0.26
12 0.22
13 0.2
14 0.2
15 0.17
16 0.13
17 0.15
18 0.16
19 0.17
20 0.18
21 0.18
22 0.21
23 0.23
24 0.29
25 0.27
26 0.26
27 0.24
28 0.22
29 0.23
30 0.2
31 0.18
32 0.11
33 0.12
34 0.13
35 0.13
36 0.14
37 0.13
38 0.13
39 0.2
40 0.23
41 0.3
42 0.33
43 0.4
44 0.43
45 0.51
46 0.59
47 0.6
48 0.68
49 0.69
50 0.75
51 0.78
52 0.82
53 0.82
54 0.81
55 0.76
56 0.7
57 0.68
58 0.65
59 0.61
60 0.61
61 0.59
62 0.52
63 0.47
64 0.44
65 0.38
66 0.31
67 0.25
68 0.16
69 0.1
70 0.08
71 0.07
72 0.06
73 0.05
74 0.05
75 0.07
76 0.09
77 0.1
78 0.15
79 0.23
80 0.24
81 0.32
82 0.36
83 0.4
84 0.5
85 0.58
86 0.6
87 0.61
88 0.62
89 0.6
90 0.63
91 0.61
92 0.55
93 0.56
94 0.56
95 0.5
96 0.5
97 0.45
98 0.37
99 0.33
100 0.29
101 0.22
102 0.17
103 0.19
104 0.17
105 0.19
106 0.21
107 0.21
108 0.2
109 0.17
110 0.14
111 0.11
112 0.11
113 0.1
114 0.08
115 0.08
116 0.07
117 0.07
118 0.08
119 0.07
120 0.06
121 0.05
122 0.04
123 0.07
124 0.1
125 0.11
126 0.11
127 0.13
128 0.18
129 0.24
130 0.33
131 0.38
132 0.47
133 0.54
134 0.6
135 0.64
136 0.63
137 0.65
138 0.58
139 0.54
140 0.45
141 0.39
142 0.32
143 0.28
144 0.26
145 0.19
146 0.17
147 0.15
148 0.15
149 0.13
150 0.13
151 0.12