Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C5M4I0

Protein Details
Accession C5M4I0   
Localization Confidence Medium
Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
104-131FDAYRECRKDFFRKKRQDKVEGKKGWGWBasic
NLS Segment(s)
PositionSequence
117-119KKR
Subcellular Location(s) nucl 20.5, cyto_nucl 13, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009069  Cys_alpha_HP_mot_SF  
Gene Ontology GO:0005758  C:mitochondrial intermembrane space  
GO:0033108  P:mitochondrial respiratory chain complex assembly  
KEGG ctp:CTRG_00970  -  
PROSITE View protein in PROSITE  
PS51808  CHCH  
Amino Acid Sequences MTTSEGSTENKQSIPEPVVLNTKPNSDKLITDEVEKDKSKVDFTKGNVEEFKFYPDNPKSHRHKYKWSMKEPSKFYDPCEESRMASMDCLYRNQDDKYVCQEFFDAYRECRKDFFRKKRQDKVEGKKGWGW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.26
3 0.23
4 0.24
5 0.3
6 0.29
7 0.32
8 0.29
9 0.32
10 0.3
11 0.3
12 0.31
13 0.26
14 0.27
15 0.27
16 0.32
17 0.27
18 0.27
19 0.3
20 0.28
21 0.32
22 0.32
23 0.28
24 0.25
25 0.25
26 0.27
27 0.25
28 0.27
29 0.27
30 0.29
31 0.38
32 0.36
33 0.37
34 0.36
35 0.34
36 0.32
37 0.27
38 0.3
39 0.2
40 0.19
41 0.25
42 0.26
43 0.3
44 0.31
45 0.4
46 0.42
47 0.52
48 0.62
49 0.57
50 0.64
51 0.69
52 0.75
53 0.75
54 0.76
55 0.75
56 0.72
57 0.76
58 0.69
59 0.64
60 0.6
61 0.52
62 0.46
63 0.46
64 0.42
65 0.36
66 0.37
67 0.34
68 0.27
69 0.28
70 0.28
71 0.19
72 0.16
73 0.15
74 0.13
75 0.13
76 0.15
77 0.16
78 0.16
79 0.19
80 0.2
81 0.24
82 0.23
83 0.25
84 0.3
85 0.32
86 0.29
87 0.27
88 0.27
89 0.23
90 0.23
91 0.25
92 0.2
93 0.19
94 0.28
95 0.3
96 0.3
97 0.33
98 0.38
99 0.45
100 0.54
101 0.62
102 0.64
103 0.73
104 0.82
105 0.88
106 0.91
107 0.91
108 0.91
109 0.91
110 0.9
111 0.85