Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C5M3P4

Protein Details
Accession C5M3P4   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
361-386ISSSKPNLRSKKSFRLKPPHHQPPSVHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 15, mito 5, E.R. 4, extr 1, golg 1, vacu 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR013635  Ice2  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0097038  C:perinuclear endoplasmic reticulum  
GO:0048309  P:endoplasmic reticulum inheritance  
GO:0006882  P:intracellular zinc ion homeostasis  
GO:0031204  P:post-translational protein targeting to membrane, translocation  
GO:0036228  P:protein localization to nuclear inner membrane  
GO:0000921  P:septin ring assembly  
KEGG ctp:CTRG_00683  -  
Pfam View protein in Pfam  
PF08426  ICE2  
Amino Acid Sequences MSLFRTISRSVRGIFSTVYLGLIILTIPLAFDVGGVYCGLAFSLTTLVTYFILTTIRIAVRRTRYFQWISIIYYCQHFFIPSLLTYFLSYYSNGVTPNESKYNPIMIWKLILINSTPLFTILEGFCSLLLIQAVGQTVNWLTLYKSDSWLILSLIGSGSVITASFYFLYRIYVLPFAIDMFSASLLGSLLTTTLGLGLFGIVSGKGSMIESSLLFAYIVKCIYETFPILSEGASQALTNLFNLTTQNLKKEIPKIPPSILNPISEVVPFLASTLPSSFKGVWKFLIMAIQTLTLPLLLNLAYRIGVFYAATKIIPSLYQSISYPSVTPPKTPQTSSRQPSSVSLSHLTDPKSPTSSSVSSISSSKPNLRSKKSFRLKPPHHQPPSVIIRLIYAYAPILIIAVYTHLMLSYNGELGTELQLWPIWNSTTSNSQDNFQIIVHPWQFWNWINMGTTLILYAAELSSNDNSSGGGNSLTSHWKVE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.27
3 0.24
4 0.21
5 0.19
6 0.14
7 0.13
8 0.1
9 0.09
10 0.07
11 0.05
12 0.05
13 0.04
14 0.04
15 0.04
16 0.04
17 0.04
18 0.04
19 0.05
20 0.05
21 0.06
22 0.06
23 0.06
24 0.05
25 0.05
26 0.05
27 0.05
28 0.04
29 0.04
30 0.06
31 0.06
32 0.06
33 0.07
34 0.08
35 0.09
36 0.09
37 0.08
38 0.08
39 0.09
40 0.09
41 0.09
42 0.12
43 0.15
44 0.17
45 0.19
46 0.26
47 0.34
48 0.41
49 0.45
50 0.45
51 0.51
52 0.52
53 0.53
54 0.52
55 0.45
56 0.43
57 0.4
58 0.38
59 0.31
60 0.31
61 0.28
62 0.23
63 0.2
64 0.17
65 0.15
66 0.15
67 0.16
68 0.13
69 0.14
70 0.14
71 0.15
72 0.15
73 0.15
74 0.14
75 0.12
76 0.12
77 0.11
78 0.12
79 0.12
80 0.13
81 0.13
82 0.16
83 0.16
84 0.21
85 0.25
86 0.24
87 0.25
88 0.26
89 0.29
90 0.26
91 0.28
92 0.25
93 0.21
94 0.22
95 0.2
96 0.2
97 0.16
98 0.17
99 0.13
100 0.15
101 0.15
102 0.14
103 0.13
104 0.12
105 0.11
106 0.11
107 0.13
108 0.09
109 0.1
110 0.1
111 0.1
112 0.1
113 0.09
114 0.09
115 0.07
116 0.07
117 0.05
118 0.05
119 0.06
120 0.06
121 0.06
122 0.06
123 0.06
124 0.06
125 0.06
126 0.07
127 0.06
128 0.06
129 0.09
130 0.12
131 0.12
132 0.14
133 0.14
134 0.14
135 0.15
136 0.15
137 0.13
138 0.11
139 0.1
140 0.08
141 0.08
142 0.07
143 0.06
144 0.05
145 0.05
146 0.04
147 0.03
148 0.03
149 0.04
150 0.05
151 0.05
152 0.06
153 0.07
154 0.07
155 0.08
156 0.09
157 0.09
158 0.1
159 0.1
160 0.1
161 0.09
162 0.09
163 0.08
164 0.07
165 0.06
166 0.05
167 0.04
168 0.05
169 0.05
170 0.04
171 0.04
172 0.04
173 0.04
174 0.04
175 0.03
176 0.03
177 0.03
178 0.03
179 0.03
180 0.03
181 0.03
182 0.03
183 0.03
184 0.03
185 0.03
186 0.03
187 0.03
188 0.02
189 0.03
190 0.03
191 0.03
192 0.03
193 0.04
194 0.04
195 0.04
196 0.05
197 0.05
198 0.06
199 0.05
200 0.05
201 0.05
202 0.06
203 0.06
204 0.06
205 0.06
206 0.05
207 0.06
208 0.06
209 0.07
210 0.08
211 0.08
212 0.07
213 0.08
214 0.09
215 0.09
216 0.08
217 0.08
218 0.07
219 0.07
220 0.06
221 0.05
222 0.05
223 0.06
224 0.06
225 0.05
226 0.05
227 0.05
228 0.05
229 0.06
230 0.06
231 0.1
232 0.11
233 0.13
234 0.14
235 0.16
236 0.18
237 0.24
238 0.29
239 0.31
240 0.36
241 0.37
242 0.37
243 0.41
244 0.4
245 0.41
246 0.37
247 0.3
248 0.26
249 0.24
250 0.22
251 0.17
252 0.15
253 0.08
254 0.07
255 0.06
256 0.06
257 0.06
258 0.05
259 0.06
260 0.07
261 0.08
262 0.09
263 0.11
264 0.11
265 0.14
266 0.17
267 0.17
268 0.17
269 0.16
270 0.16
271 0.15
272 0.17
273 0.14
274 0.12
275 0.11
276 0.11
277 0.09
278 0.09
279 0.08
280 0.05
281 0.05
282 0.04
283 0.05
284 0.04
285 0.04
286 0.04
287 0.05
288 0.05
289 0.05
290 0.05
291 0.04
292 0.05
293 0.05
294 0.05
295 0.07
296 0.07
297 0.07
298 0.07
299 0.07
300 0.07
301 0.07
302 0.08
303 0.1
304 0.11
305 0.12
306 0.12
307 0.15
308 0.17
309 0.17
310 0.16
311 0.15
312 0.22
313 0.22
314 0.24
315 0.26
316 0.32
317 0.35
318 0.37
319 0.41
320 0.43
321 0.52
322 0.55
323 0.55
324 0.49
325 0.47
326 0.47
327 0.46
328 0.4
329 0.33
330 0.31
331 0.28
332 0.28
333 0.31
334 0.3
335 0.28
336 0.28
337 0.27
338 0.27
339 0.25
340 0.25
341 0.28
342 0.27
343 0.25
344 0.26
345 0.24
346 0.23
347 0.25
348 0.24
349 0.23
350 0.24
351 0.28
352 0.34
353 0.42
354 0.49
355 0.56
356 0.63
357 0.67
358 0.75
359 0.79
360 0.79
361 0.81
362 0.83
363 0.84
364 0.85
365 0.87
366 0.87
367 0.83
368 0.77
369 0.69
370 0.67
371 0.67
372 0.59
373 0.48
374 0.37
375 0.32
376 0.3
377 0.29
378 0.2
379 0.12
380 0.09
381 0.08
382 0.08
383 0.07
384 0.06
385 0.05
386 0.05
387 0.04
388 0.05
389 0.05
390 0.05
391 0.05
392 0.05
393 0.06
394 0.06
395 0.09
396 0.09
397 0.1
398 0.1
399 0.1
400 0.1
401 0.1
402 0.13
403 0.11
404 0.1
405 0.1
406 0.11
407 0.12
408 0.12
409 0.13
410 0.12
411 0.12
412 0.14
413 0.16
414 0.23
415 0.26
416 0.32
417 0.31
418 0.31
419 0.33
420 0.32
421 0.31
422 0.23
423 0.23
424 0.19
425 0.26
426 0.26
427 0.25
428 0.24
429 0.24
430 0.29
431 0.27
432 0.28
433 0.21
434 0.22
435 0.22
436 0.22
437 0.22
438 0.18
439 0.16
440 0.13
441 0.11
442 0.08
443 0.07
444 0.07
445 0.06
446 0.06
447 0.06
448 0.1
449 0.11
450 0.13
451 0.13
452 0.12
453 0.13
454 0.13
455 0.14
456 0.12
457 0.1
458 0.09
459 0.1
460 0.13
461 0.18