FuNGI

C5M3P4

Protein Details

Accession

C5M3P4

Localization Confidence

Low

Confidence Score

NoLS Segment(s)

Position	Sequence	Protein Nature
361-386	ISSSKPNLRSKKSFRLKPPHHQPPSV	Hydrophilic

NLS Segment(s)

Subcellular Location(s)

plas 15, mito 5, E.R. 4, extr 1, golg 1, vacu 1

Family & Domain DBs

InterPro	View protein in InterPro IPR013635 Ice2
Gene Ontology	GO:0005789 C:endoplasmic reticulum membrane GO:0097038 C:perinuclear endoplasmic reticulum GO:0048309 P:endoplasmic reticulum inheritance GO:0006882 P:intracellular zinc ion homeostasis GO:0031204 P:post-translational protein targeting to membrane, translocation GO:0036228 P:protein localization to nuclear inner membrane GO:0000921 P:septin ring assembly
KEGG	ctp:CTRG_00683 -
Pfam	View protein in Pfam PF08426 ICE2

Amino Acid Sequences

MSLFRTISRSVRGIFSTVYLGLIILTIPLAFDVGGVYCGLAFSLTTLVTYFILTTIRIAVRRTRYFQWISIIYYCQHFFIPSLLTYFLSYYSNGVTPNESKYNPIMIWKLILINSTPLFTILEGFCSLLLIQAVGQTVNWLTLYKSDSWLILSLIGSGSVITASFYFLYRIYVLPFAIDMFSASLLGSLLTTTLGLGLFGIVSGKGSMIESSLLFAYIVKCIYETFPILSEGASQALTNLFNLTTQNLKKEIPKIPPSILNPISEVVPFLASTLPSSFKGVWKFLIMAIQTLTLPLLLNLAYRIGVFYAATKIIPSLYQSISYPSVTPPKTPQTSSRQPSSVSLSHLTDPKSPTSSSVSSISSSKPNLRSKKSFRLKPPHHQPPSVIIRLIYAYAPILIIAVYTHLMLSYNGELGTELQLWPIWNSTTSNSQDNFQIIVHPWQFWNWINMGTTLILYAAELSSNDNSSGGGNSLTSHWKVE

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.29
2	0.27
3	0.24
4	0.21
5	0.19
6	0.14
7	0.13
8	0.1
9	0.09
10	0.07
11	0.05
12	0.05
13	0.04
14	0.04
15	0.04
16	0.04
17	0.04
18	0.04
19	0.05
20	0.05
21	0.06
22	0.06
23	0.06
24	0.05
25	0.05
26	0.05
27	0.05
28	0.04
29	0.04
30	0.06
31	0.06
32	0.06
33	0.07
34	0.08
35	0.09
36	0.09
37	0.08
38	0.08
39	0.09
40	0.09
41	0.09
42	0.12
43	0.15
44	0.17
45	0.19
46	0.26
47	0.34
48	0.41
49	0.45
50	0.45
51	0.51
52	0.52
53	0.53
54	0.52
55	0.45
56	0.43
57	0.4
58	0.38
59	0.31
60	0.31
61	0.28
62	0.23
63	0.2
64	0.17
65	0.15
66	0.15
67	0.16
68	0.13
69	0.14
70	0.14
71	0.15
72	0.15
73	0.15
74	0.14
75	0.12
76	0.12
77	0.11
78	0.12
79	0.12
80	0.13
81	0.13
82	0.16
83	0.16
84	0.21
85	0.25
86	0.24
87	0.25
88	0.26
89	0.29
90	0.26
91	0.28
92	0.25
93	0.21
94	0.22
95	0.2
96	0.2
97	0.16
98	0.17
99	0.13
100	0.15
101	0.15
102	0.14
103	0.13
104	0.12
105	0.11
106	0.11
107	0.13
108	0.09
109	0.1
110	0.1
111	0.1
112	0.1
113	0.09
114	0.09
115	0.07
116	0.07
117	0.05
118	0.05
119	0.06
120	0.06
121	0.06
122	0.06
123	0.06
124	0.06
125	0.06
126	0.07
127	0.06
128	0.06
129	0.09
130	0.12
131	0.12
132	0.14
133	0.14
134	0.14
135	0.15
136	0.15
137	0.13
138	0.11
139	0.1
140	0.08
141	0.08
142	0.07
143	0.06
144	0.05
145	0.05
146	0.04
147	0.03
148	0.03
149	0.04
150	0.05
151	0.05
152	0.06
153	0.07
154	0.07
155	0.08
156	0.09
157	0.09
158	0.1
159	0.1
160	0.1
161	0.09
162	0.09
163	0.08
164	0.07
165	0.06
166	0.05
167	0.04
168	0.05
169	0.05
170	0.04
171	0.04
172	0.04
173	0.04
174	0.04
175	0.03
176	0.03
177	0.03
178	0.03
179	0.03
180	0.03
181	0.03
182	0.03
183	0.03
184	0.03
185	0.03
186	0.03
187	0.03
188	0.02
189	0.03
190	0.03
191	0.03
192	0.03
193	0.04
194	0.04
195	0.04
196	0.05
197	0.05
198	0.06
199	0.05
200	0.05
201	0.05
202	0.06
203	0.06
204	0.06
205	0.06
206	0.05
207	0.06
208	0.06
209	0.07
210	0.08
211	0.08
212	0.07
213	0.08
214	0.09
215	0.09
216	0.08
217	0.08
218	0.07
219	0.07
220	0.06
221	0.05
222	0.05
223	0.06
224	0.06
225	0.05
226	0.05
227	0.05
228	0.05
229	0.06
230	0.06
231	0.1
232	0.11
233	0.13
234	0.14
235	0.16
236	0.18
237	0.24
238	0.29
239	0.31
240	0.36
241	0.37
242	0.37
243	0.41
244	0.4
245	0.41
246	0.37
247	0.3
248	0.26
249	0.24
250	0.22
251	0.17
252	0.15
253	0.08
254	0.07
255	0.06
256	0.06
257	0.06
258	0.05
259	0.06
260	0.07
261	0.08
262	0.09
263	0.11
264	0.11
265	0.14
266	0.17
267	0.17
268	0.17
269	0.16
270	0.16
271	0.15
272	0.17
273	0.14
274	0.12
275	0.11
276	0.11
277	0.09
278	0.09
279	0.08
280	0.05
281	0.05
282	0.04
283	0.05
284	0.04
285	0.04
286	0.04
287	0.05
288	0.05
289	0.05
290	0.05
291	0.04
292	0.05
293	0.05
294	0.05
295	0.07
296	0.07
297	0.07
298	0.07
299	0.07
300	0.07
301	0.07
302	0.08
303	0.1
304	0.11
305	0.12
306	0.12
307	0.15
308	0.17
309	0.17
310	0.16
311	0.15
312	0.22
313	0.22
314	0.24
315	0.26
316	0.32
317	0.35
318	0.37
319	0.41
320	0.43
321	0.52
322	0.55
323	0.55
324	0.49
325	0.47
326	0.47
327	0.46
328	0.4
329	0.33
330	0.31
331	0.28
332	0.28
333	0.31
334	0.3
335	0.28
336	0.28
337	0.27
338	0.27
339	0.25
340	0.25
341	0.28
342	0.27
343	0.25
344	0.26
345	0.24
346	0.23
347	0.25
348	0.24
349	0.23
350	0.24
351	0.28
352	0.34
353	0.42
354	0.49
355	0.56
356	0.63
357	0.67
358	0.75
359	0.79
360	0.79
361	0.81
362	0.83
363	0.84
364	0.85
365	0.87
366	0.87
367	0.83
368	0.77
369	0.69
370	0.67
371	0.67
372	0.59
373	0.48
374	0.37
375	0.32
376	0.3
377	0.29
378	0.2
379	0.12
380	0.09
381	0.08
382	0.08
383	0.07
384	0.06
385	0.05
386	0.05
387	0.04
388	0.05
389	0.05
390	0.05
391	0.05
392	0.05
393	0.06
394	0.06
395	0.09
396	0.09
397	0.1
398	0.1
399	0.1
400	0.1
401	0.1
402	0.13
403	0.11
404	0.1
405	0.1
406	0.11
407	0.12
408	0.12
409	0.13
410	0.12
411	0.12
412	0.14
413	0.16
414	0.23
415	0.26
416	0.32
417	0.31
418	0.31
419	0.33
420	0.32
421	0.31
422	0.23
423	0.23
424	0.19
425	0.26
426	0.26
427	0.25
428	0.24
429	0.24
430	0.29
431	0.27
432	0.28
433	0.21
434	0.22
435	0.22
436	0.22
437	0.22
438	0.18
439	0.16
440	0.13
441	0.11
442	0.08
443	0.07
444	0.07
445	0.06
446	0.06
447	0.06
448	0.1
449	0.11
450	0.13
451	0.13
452	0.12
453	0.13
454	0.13
455	0.14
456	0.12
457	0.1
458	0.09
459	0.1
460	0.13
461	0.18

C5M3P4

3D AlphaFold-predicted Structure Viewer