Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N7BL58

Protein Details
Accession A0A5N7BL58    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
304-330GPMLRRLCWPSRRFRRTRHCLLYRASFHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, plas 10, cyto 2, pero 1, E.R. 1, vacu 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR023271  Aquaporin-like  
IPR000425  MIP  
IPR022357  MIP_CS  
Gene Ontology GO:0016020  C:membrane  
GO:0015267  F:channel activity  
Pfam View protein in Pfam  
PF00230  MIP  
PROSITE View protein in PROSITE  
PS00221  MIP  
Amino Acid Sequences MAVLRTQSCITATWANIPRPKPVIQPFAGRIGGNQELVVDRTDPENADLLKKVPDAAPLMSLLEGFDPHAFWDLDLWKFGFIECIGTMMMVFMTSWIAIRPASTPTTPNETSPSGVFSTSAFLGPMFSGISNWIFLTLFIFTFSSVTGGHLNPTITLATVFARLISVPRMVIYLLGQTLGGALAGFMLRSAYGTRDFTVGGCIVDPSLVPPDEAFLLEFIFSLVLIFLSFGVGLDPRQSSIYGAAMSPFLVGMTLGAVSWGSAFTRVGYAGACEYTDQPSGHFERRNSQKDILTHWLYGSIEPGPMLRRLCWPSRRFRRTRHCLLYRASFREFKVAYDAGIAEGGSCRLH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.41
3 0.46
4 0.46
5 0.48
6 0.48
7 0.5
8 0.49
9 0.51
10 0.53
11 0.49
12 0.55
13 0.52
14 0.54
15 0.53
16 0.44
17 0.36
18 0.34
19 0.33
20 0.25
21 0.22
22 0.17
23 0.16
24 0.17
25 0.18
26 0.12
27 0.11
28 0.12
29 0.14
30 0.13
31 0.14
32 0.17
33 0.17
34 0.19
35 0.19
36 0.19
37 0.21
38 0.2
39 0.21
40 0.17
41 0.2
42 0.2
43 0.19
44 0.19
45 0.17
46 0.17
47 0.15
48 0.14
49 0.1
50 0.08
51 0.08
52 0.08
53 0.07
54 0.07
55 0.07
56 0.11
57 0.1
58 0.1
59 0.13
60 0.15
61 0.16
62 0.17
63 0.17
64 0.14
65 0.14
66 0.14
67 0.13
68 0.09
69 0.11
70 0.09
71 0.1
72 0.09
73 0.09
74 0.09
75 0.07
76 0.07
77 0.04
78 0.04
79 0.03
80 0.04
81 0.04
82 0.04
83 0.04
84 0.05
85 0.05
86 0.06
87 0.07
88 0.1
89 0.12
90 0.13
91 0.15
92 0.17
93 0.25
94 0.25
95 0.25
96 0.26
97 0.24
98 0.25
99 0.23
100 0.23
101 0.16
102 0.15
103 0.15
104 0.11
105 0.12
106 0.11
107 0.11
108 0.08
109 0.07
110 0.08
111 0.07
112 0.07
113 0.06
114 0.05
115 0.05
116 0.06
117 0.07
118 0.07
119 0.07
120 0.07
121 0.06
122 0.06
123 0.07
124 0.06
125 0.06
126 0.06
127 0.06
128 0.06
129 0.06
130 0.06
131 0.06
132 0.06
133 0.07
134 0.08
135 0.08
136 0.09
137 0.1
138 0.1
139 0.09
140 0.1
141 0.08
142 0.06
143 0.06
144 0.06
145 0.06
146 0.07
147 0.06
148 0.05
149 0.06
150 0.05
151 0.06
152 0.07
153 0.07
154 0.06
155 0.06
156 0.06
157 0.06
158 0.07
159 0.06
160 0.05
161 0.05
162 0.05
163 0.05
164 0.04
165 0.04
166 0.04
167 0.03
168 0.02
169 0.02
170 0.02
171 0.02
172 0.02
173 0.02
174 0.02
175 0.02
176 0.03
177 0.04
178 0.05
179 0.07
180 0.09
181 0.09
182 0.1
183 0.1
184 0.1
185 0.11
186 0.1
187 0.08
188 0.07
189 0.07
190 0.06
191 0.06
192 0.06
193 0.05
194 0.07
195 0.07
196 0.07
197 0.07
198 0.08
199 0.08
200 0.08
201 0.07
202 0.05
203 0.05
204 0.05
205 0.05
206 0.04
207 0.04
208 0.04
209 0.03
210 0.03
211 0.03
212 0.03
213 0.03
214 0.03
215 0.03
216 0.03
217 0.03
218 0.04
219 0.04
220 0.04
221 0.06
222 0.06
223 0.07
224 0.08
225 0.09
226 0.09
227 0.1
228 0.11
229 0.1
230 0.09
231 0.09
232 0.08
233 0.08
234 0.08
235 0.06
236 0.05
237 0.04
238 0.04
239 0.03
240 0.03
241 0.03
242 0.03
243 0.03
244 0.03
245 0.03
246 0.04
247 0.04
248 0.04
249 0.05
250 0.05
251 0.06
252 0.07
253 0.07
254 0.07
255 0.07
256 0.08
257 0.08
258 0.08
259 0.08
260 0.08
261 0.09
262 0.12
263 0.15
264 0.14
265 0.14
266 0.19
267 0.24
268 0.29
269 0.32
270 0.31
271 0.37
272 0.48
273 0.53
274 0.53
275 0.53
276 0.53
277 0.5
278 0.55
279 0.54
280 0.47
281 0.41
282 0.36
283 0.34
284 0.29
285 0.27
286 0.22
287 0.15
288 0.12
289 0.12
290 0.13
291 0.12
292 0.16
293 0.18
294 0.17
295 0.24
296 0.3
297 0.38
298 0.46
299 0.51
300 0.58
301 0.68
302 0.77
303 0.77
304 0.82
305 0.85
306 0.85
307 0.89
308 0.89
309 0.85
310 0.81
311 0.8
312 0.8
313 0.77
314 0.73
315 0.68
316 0.61
317 0.55
318 0.57
319 0.51
320 0.42
321 0.41
322 0.35
323 0.3
324 0.27
325 0.26
326 0.18
327 0.18
328 0.16
329 0.1
330 0.1