Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C5M9U1

Protein Details
Accession C5M9U1    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
9-38QHIKKHGRRLDYEERKRKKEAREGHRIAKDBasic
NLS Segment(s)
PositionSequence
12-74KKHGRRLDYEERKRKKEAREGHRIAKDAQTLKGWRGKQFAKKRYAEKVAMKKKIKAHQESKVK
Subcellular Location(s) nucl 14.5, cyto_nucl 12.333, mito_nucl 8.666, cyto 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR039411  NSA2_fam  
IPR022309  Ribosomal_S8e/biogenesis_NSA2  
Gene Ontology GO:0005730  C:nucleolus  
GO:0030687  C:preribosome, large subunit precursor  
GO:0000466  P:maturation of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
KEGG ctp:CTRG_02253  -  
Pfam View protein in Pfam  
PF01201  Ribosomal_S8e  
CDD cd11381  NSA2  
Amino Acid Sequences MPQNEYIEQHIKKHGRRLDYEERKRKKEAREGHRIAKDAQTLKGWRGKQFAKKRYAEKVAMKKKIKAHQESKVKGPSTPKVDDGEALPTYLLDRQTNNTAKAISSSIKQKRLEKADKFQVPLPKVKGISEEEMFKVIKTGKSKSKSWKRMITKHTFVGEGFTRRPVKMERIIRPAALRQKKANVTHPELGVTVFLPILGVKKNPQSPMYTQLGVLTKGTIIEVNVSELGLVTAGGKVVWGKYAQITNEPDRDGCVNAVLLV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.57
3 0.61
4 0.66
5 0.68
6 0.71
7 0.77
8 0.79
9 0.82
10 0.8
11 0.83
12 0.81
13 0.79
14 0.78
15 0.78
16 0.76
17 0.79
18 0.8
19 0.81
20 0.79
21 0.71
22 0.64
23 0.59
24 0.56
25 0.48
26 0.43
27 0.4
28 0.37
29 0.39
30 0.44
31 0.41
32 0.39
33 0.43
34 0.48
35 0.52
36 0.6
37 0.64
38 0.67
39 0.7
40 0.72
41 0.74
42 0.75
43 0.72
44 0.71
45 0.73
46 0.73
47 0.76
48 0.73
49 0.7
50 0.71
51 0.71
52 0.71
53 0.69
54 0.67
55 0.67
56 0.73
57 0.7
58 0.7
59 0.69
60 0.6
61 0.54
62 0.52
63 0.49
64 0.46
65 0.45
66 0.4
67 0.35
68 0.34
69 0.32
70 0.27
71 0.25
72 0.18
73 0.16
74 0.13
75 0.11
76 0.11
77 0.12
78 0.13
79 0.09
80 0.11
81 0.13
82 0.21
83 0.24
84 0.25
85 0.24
86 0.22
87 0.21
88 0.21
89 0.21
90 0.14
91 0.14
92 0.22
93 0.27
94 0.34
95 0.37
96 0.41
97 0.46
98 0.54
99 0.61
100 0.56
101 0.58
102 0.6
103 0.6
104 0.56
105 0.53
106 0.5
107 0.43
108 0.43
109 0.38
110 0.32
111 0.29
112 0.28
113 0.27
114 0.24
115 0.24
116 0.2
117 0.19
118 0.16
119 0.17
120 0.17
121 0.14
122 0.13
123 0.12
124 0.14
125 0.16
126 0.2
127 0.26
128 0.31
129 0.36
130 0.45
131 0.54
132 0.6
133 0.65
134 0.7
135 0.7
136 0.75
137 0.78
138 0.76
139 0.7
140 0.64
141 0.58
142 0.49
143 0.41
144 0.36
145 0.3
146 0.24
147 0.21
148 0.23
149 0.24
150 0.23
151 0.26
152 0.25
153 0.28
154 0.33
155 0.41
156 0.42
157 0.46
158 0.48
159 0.46
160 0.45
161 0.45
162 0.47
163 0.46
164 0.43
165 0.4
166 0.46
167 0.52
168 0.54
169 0.57
170 0.55
171 0.55
172 0.55
173 0.52
174 0.45
175 0.38
176 0.34
177 0.25
178 0.17
179 0.11
180 0.07
181 0.06
182 0.05
183 0.05
184 0.06
185 0.08
186 0.09
187 0.12
188 0.19
189 0.23
190 0.27
191 0.29
192 0.32
193 0.33
194 0.39
195 0.41
196 0.35
197 0.31
198 0.32
199 0.32
200 0.28
201 0.25
202 0.18
203 0.13
204 0.13
205 0.13
206 0.09
207 0.07
208 0.09
209 0.09
210 0.11
211 0.11
212 0.1
213 0.1
214 0.09
215 0.09
216 0.06
217 0.06
218 0.04
219 0.04
220 0.05
221 0.04
222 0.05
223 0.06
224 0.06
225 0.09
226 0.09
227 0.1
228 0.14
229 0.19
230 0.21
231 0.26
232 0.32
233 0.36
234 0.4
235 0.4
236 0.36
237 0.35
238 0.35
239 0.3
240 0.25
241 0.2