Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N7BQW6

Protein Details
Accession A0A5N7BQW6    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
84-112ASCPLCRRKFYEYRRPRKIRTLRSNPSADHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19, mito_nucl 12.333, cyto_nucl 11.833, mito 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001841  Znf_RING  
IPR013083  Znf_RING/FYVE/PHD  
Pfam View protein in Pfam  
PF13639  zf-RING_2  
PROSITE View protein in PROSITE  
PS50089  ZF_RING_2  
CDD cd16448  RING-H2  
Amino Acid Sequences MAQYYLHMPSPTERGGFTKQELVLAPMPCYFGSKDWMVSLPCALPKECELCLEQLGPDSAYRTLPCKHIFHLPCIDCWLCTEDASCPLCRRKFYEYRRPRKIRTLRSNPSADEVSHRCDVSLRGIKLWFRQRLSTH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.28
3 0.31
4 0.3
5 0.31
6 0.29
7 0.3
8 0.3
9 0.29
10 0.29
11 0.26
12 0.25
13 0.2
14 0.21
15 0.18
16 0.2
17 0.17
18 0.13
19 0.16
20 0.16
21 0.16
22 0.16
23 0.19
24 0.17
25 0.16
26 0.16
27 0.13
28 0.15
29 0.15
30 0.14
31 0.13
32 0.14
33 0.17
34 0.16
35 0.16
36 0.15
37 0.15
38 0.16
39 0.14
40 0.12
41 0.1
42 0.11
43 0.09
44 0.08
45 0.08
46 0.08
47 0.08
48 0.09
49 0.11
50 0.12
51 0.16
52 0.19
53 0.19
54 0.2
55 0.28
56 0.29
57 0.29
58 0.36
59 0.32
60 0.29
61 0.31
62 0.3
63 0.21
64 0.21
65 0.2
66 0.13
67 0.12
68 0.13
69 0.1
70 0.15
71 0.17
72 0.17
73 0.18
74 0.25
75 0.28
76 0.29
77 0.33
78 0.36
79 0.44
80 0.52
81 0.6
82 0.64
83 0.72
84 0.81
85 0.84
86 0.8
87 0.81
88 0.82
89 0.82
90 0.82
91 0.83
92 0.8
93 0.8
94 0.79
95 0.69
96 0.64
97 0.54
98 0.44
99 0.4
100 0.34
101 0.32
102 0.31
103 0.3
104 0.25
105 0.25
106 0.26
107 0.29
108 0.35
109 0.31
110 0.31
111 0.35
112 0.38
113 0.45
114 0.53
115 0.51
116 0.46