Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N7AWK5

Protein Details
Accession A0A5N7AWK5    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
3-30LAKKHVPIVKKRTKTFKRHQSDRFKCVPHydrophilic
NLS Segment(s)
PositionSequence
11-21VKKRTKTFKRH
33-48WRKPKGIDSRVRRRFK
Subcellular Location(s) mito 18.5, mito_nucl 13.5, nucl 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
Amino Acid Sequences MVLAKKHVPIVKKRTKTFKRHQSDRFKCVPESWRKPKGIDSRVRRRFKSNIPMPSVRFSPPSRSRPGSDGSQRDR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.8
3 0.84
4 0.85
5 0.85
6 0.85
7 0.85
8 0.88
9 0.88
10 0.87
11 0.84
12 0.8
13 0.72
14 0.63
15 0.58
16 0.56
17 0.55
18 0.57
19 0.58
20 0.59
21 0.57
22 0.57
23 0.61
24 0.61
25 0.59
26 0.58
27 0.59
28 0.63
29 0.71
30 0.76
31 0.7
32 0.67
33 0.65
34 0.65
35 0.66
36 0.63
37 0.61
38 0.62
39 0.65
40 0.61
41 0.59
42 0.52
43 0.43
44 0.4
45 0.34
46 0.38
47 0.42
48 0.46
49 0.5
50 0.53
51 0.54
52 0.53
53 0.55
54 0.54
55 0.55