Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N7BP29

Protein Details
Accession A0A5N7BP29   
Localization Confidence Medium
Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
113-142LLEGGGKRKEIKKRTKKSHVRDQIRLKGFNBasic
NLS Segment(s)
PositionSequence
118-132GKRKEIKKRTKKSHV
Subcellular Location(s) nucl 8.5, mito 8, cyto_nucl 8, cyto 6.5, pero 3
Family & Domain DBs
Amino Acid Sequences MSLLDHTNLLVLADLVKTKPTRTNHRNPDGQWRPLYHGQRILYVHLDLPVPFHGLDTGHSSKDEVHPHIREKGWAATEGVHSQLSGSPRVTIMAFYLSARDLPITTDCCLSLLLEGGGKRKEIKKRTKKSHVRDQIRLKGFNLNRSGLN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.13
4 0.13
5 0.16
6 0.23
7 0.3
8 0.4
9 0.49
10 0.59
11 0.65
12 0.73
13 0.77
14 0.72
15 0.76
16 0.72
17 0.69
18 0.62
19 0.54
20 0.53
21 0.54
22 0.56
23 0.49
24 0.47
25 0.42
26 0.43
27 0.41
28 0.37
29 0.3
30 0.26
31 0.23
32 0.18
33 0.17
34 0.12
35 0.13
36 0.11
37 0.1
38 0.1
39 0.09
40 0.08
41 0.08
42 0.09
43 0.14
44 0.15
45 0.14
46 0.15
47 0.15
48 0.16
49 0.2
50 0.23
51 0.19
52 0.23
53 0.26
54 0.28
55 0.32
56 0.31
57 0.27
58 0.26
59 0.25
60 0.2
61 0.18
62 0.16
63 0.13
64 0.14
65 0.14
66 0.13
67 0.1
68 0.08
69 0.08
70 0.1
71 0.1
72 0.11
73 0.1
74 0.1
75 0.1
76 0.11
77 0.11
78 0.09
79 0.08
80 0.08
81 0.08
82 0.07
83 0.08
84 0.07
85 0.08
86 0.08
87 0.07
88 0.06
89 0.07
90 0.1
91 0.12
92 0.13
93 0.13
94 0.13
95 0.13
96 0.13
97 0.12
98 0.09
99 0.08
100 0.07
101 0.08
102 0.09
103 0.13
104 0.14
105 0.14
106 0.19
107 0.25
108 0.34
109 0.42
110 0.53
111 0.6
112 0.7
113 0.8
114 0.87
115 0.91
116 0.91
117 0.92
118 0.92
119 0.9
120 0.89
121 0.88
122 0.87
123 0.84
124 0.77
125 0.67
126 0.66
127 0.61
128 0.59
129 0.54