Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N7ATD1

Protein Details
Accession A0A5N7ATD1    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
1-36MAPASRISRRHAPRKLGSRRRTHPKTFTPPKSPQSIHydrophilic
NLS Segment(s)
PositionSequence
7-26ISRRHAPRKLGSRRRTHPKT
Subcellular Location(s) mito 21, nucl 3, cyto 3, cyto_nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR018744  DUF2293  
Pfam View protein in Pfam  
PF10056  DUF2293  
Amino Acid Sequences MAPASRISRRHAPRKLGSRRRTHPKTFTPPKSPQSILAQARRNSLTSRRDRGGLFGTGGNNRPKVGGRAAKYSKFGLIPRSTEPFEKNCFEKEPFAPDYVFVPKGDVYVTRNCRTNTKESERIVYTVFDKTGKRTLGIRVPSDIYTAVLESAAATAETRANAVKIRDERDLAHSRQTLRAQFPLMPVESLEAVLNHAFLKGSGRVGRTATKSDERKADLAVEAHIRHTHTPYESMLRTGTDREEARNAVWGLVKAIKAAWEGGDSKPMDVLALRNRMVELN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.86
3 0.87
4 0.86
5 0.86
6 0.87
7 0.89
8 0.89
9 0.87
10 0.86
11 0.85
12 0.87
13 0.87
14 0.87
15 0.84
16 0.84
17 0.8
18 0.78
19 0.69
20 0.63
21 0.6
22 0.6
23 0.59
24 0.58
25 0.61
26 0.56
27 0.59
28 0.56
29 0.5
30 0.44
31 0.45
32 0.47
33 0.48
34 0.53
35 0.49
36 0.51
37 0.5
38 0.5
39 0.46
40 0.37
41 0.3
42 0.26
43 0.26
44 0.26
45 0.3
46 0.3
47 0.27
48 0.25
49 0.25
50 0.24
51 0.25
52 0.3
53 0.32
54 0.31
55 0.4
56 0.45
57 0.46
58 0.47
59 0.45
60 0.4
61 0.36
62 0.34
63 0.32
64 0.3
65 0.3
66 0.31
67 0.34
68 0.33
69 0.33
70 0.35
71 0.31
72 0.33
73 0.33
74 0.31
75 0.29
76 0.32
77 0.31
78 0.32
79 0.29
80 0.31
81 0.29
82 0.29
83 0.26
84 0.23
85 0.23
86 0.22
87 0.22
88 0.15
89 0.15
90 0.13
91 0.13
92 0.13
93 0.12
94 0.12
95 0.19
96 0.25
97 0.26
98 0.31
99 0.32
100 0.36
101 0.39
102 0.43
103 0.43
104 0.45
105 0.5
106 0.46
107 0.5
108 0.46
109 0.43
110 0.36
111 0.29
112 0.23
113 0.17
114 0.16
115 0.14
116 0.14
117 0.15
118 0.2
119 0.19
120 0.18
121 0.19
122 0.22
123 0.25
124 0.28
125 0.27
126 0.23
127 0.24
128 0.23
129 0.22
130 0.18
131 0.12
132 0.09
133 0.08
134 0.07
135 0.05
136 0.05
137 0.04
138 0.04
139 0.03
140 0.03
141 0.03
142 0.04
143 0.04
144 0.05
145 0.05
146 0.05
147 0.06
148 0.08
149 0.09
150 0.14
151 0.16
152 0.2
153 0.21
154 0.22
155 0.23
156 0.28
157 0.34
158 0.3
159 0.32
160 0.32
161 0.32
162 0.36
163 0.38
164 0.35
165 0.32
166 0.33
167 0.28
168 0.27
169 0.27
170 0.25
171 0.21
172 0.17
173 0.15
174 0.14
175 0.12
176 0.11
177 0.09
178 0.06
179 0.07
180 0.07
181 0.07
182 0.06
183 0.06
184 0.06
185 0.06
186 0.09
187 0.09
188 0.12
189 0.15
190 0.16
191 0.18
192 0.2
193 0.25
194 0.25
195 0.28
196 0.29
197 0.35
198 0.38
199 0.41
200 0.45
201 0.43
202 0.41
203 0.38
204 0.35
205 0.29
206 0.25
207 0.23
208 0.22
209 0.19
210 0.2
211 0.2
212 0.2
213 0.2
214 0.22
215 0.23
216 0.21
217 0.23
218 0.23
219 0.28
220 0.27
221 0.27
222 0.25
223 0.23
224 0.22
225 0.22
226 0.21
227 0.21
228 0.22
229 0.24
230 0.27
231 0.27
232 0.26
233 0.31
234 0.29
235 0.25
236 0.26
237 0.23
238 0.22
239 0.24
240 0.23
241 0.17
242 0.17
243 0.17
244 0.16
245 0.16
246 0.14
247 0.14
248 0.16
249 0.16
250 0.23
251 0.21
252 0.21
253 0.21
254 0.19
255 0.17
256 0.16
257 0.21
258 0.22
259 0.28
260 0.28
261 0.28