Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C5MIA2

Protein Details
Accession C5MIA2    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
137-158TEVRPSYKKLLEKREKRKKTWFBasic
NLS Segment(s)
PositionSequence
145-155KLLEKREKRKK
Subcellular Location(s) nucl 12, mito 10, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR037507  MrpL25  
IPR040922  MRPL25_dom  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
KEGG ctp:CTRG_05795  -  
Pfam View protein in Pfam  
PF18126  Mitoc_mL59  
Amino Acid Sequences MASQLTSKEAFAKLPQTLHNFFIKYPPRPFVQYAAGPSKTTDPMKNPFFPNKNPETGRWQEPKYSRRRSADLFKMAKKFGIQDLLPPTPRKFHEDKYQNKIWVQSMVNPVDEVKAAEYEARMKAKEEAIANMDKIITEVRPSYKKLLEKREKRKKTWF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.32
3 0.35
4 0.36
5 0.38
6 0.39
7 0.35
8 0.33
9 0.39
10 0.41
11 0.41
12 0.43
13 0.43
14 0.41
15 0.45
16 0.47
17 0.42
18 0.4
19 0.37
20 0.38
21 0.41
22 0.39
23 0.35
24 0.34
25 0.32
26 0.31
27 0.31
28 0.29
29 0.27
30 0.33
31 0.38
32 0.42
33 0.43
34 0.48
35 0.49
36 0.5
37 0.52
38 0.49
39 0.51
40 0.48
41 0.46
42 0.45
43 0.45
44 0.48
45 0.46
46 0.43
47 0.43
48 0.48
49 0.54
50 0.56
51 0.6
52 0.6
53 0.58
54 0.61
55 0.59
56 0.61
57 0.6
58 0.59
59 0.55
60 0.52
61 0.5
62 0.46
63 0.42
64 0.34
65 0.27
66 0.19
67 0.19
68 0.14
69 0.15
70 0.2
71 0.22
72 0.24
73 0.24
74 0.24
75 0.24
76 0.26
77 0.28
78 0.27
79 0.29
80 0.38
81 0.45
82 0.52
83 0.55
84 0.6
85 0.56
86 0.53
87 0.51
88 0.42
89 0.38
90 0.31
91 0.29
92 0.3
93 0.28
94 0.27
95 0.25
96 0.23
97 0.19
98 0.18
99 0.13
100 0.08
101 0.07
102 0.07
103 0.08
104 0.08
105 0.11
106 0.15
107 0.17
108 0.16
109 0.18
110 0.21
111 0.22
112 0.25
113 0.23
114 0.22
115 0.23
116 0.25
117 0.23
118 0.21
119 0.19
120 0.15
121 0.14
122 0.13
123 0.1
124 0.1
125 0.14
126 0.2
127 0.24
128 0.27
129 0.33
130 0.38
131 0.46
132 0.52
133 0.6
134 0.64
135 0.71
136 0.79
137 0.85
138 0.88