FuNGI

Q754L1

Protein Details

Accession

Q754L1

Localization Confidence

Low

Confidence Score

8.7

NoLS Segment(s)

Position	Sequence	Protein Nature
327-354	GSRTPPPKPRKPTTLKTRKPPRKELVGS	Basic

NLS Segment(s)

Position	Sequence
329-349	RTPPPKPRKPTTLKTRKPPRK

Subcellular Location(s)

cyto 18.5, cyto_nucl 12.166, cyto_mito 10.499, nucl 3.5, pero 3

Family & Domain DBs

InterPro	View protein in InterPro IPR001837 Adenylate_cyclase-assoc_CAP IPR013912 Adenylate_cyclase-assoc_CAP_C IPR013992 Adenylate_cyclase-assoc_CAP_N IPR017901 C-CAP_CF_C-like IPR016098 CAP/MinC_C IPR036223 CAP_C_sf IPR028417 CAP_CS_C IPR018106 CAP_CS_N IPR036222 CAP_N_sf IPR006599 CARP_motif
Gene Ontology	GO:0030479 C:actin cortical patch GO:0005737 C:cytoplasm GO:0000935 C:division septum GO:0035838 C:growing cell tip GO:0003779 F:actin binding GO:0008179 F:adenylate cyclase binding GO:0042802 F:identical protein binding GO:0030042 P:actin filament depolymerization GO:0007015 P:actin filament organization GO:0051014 P:actin filament severing GO:0010619 P:adenylate cyclase-activating glucose-activated G protein-coupled receptor signaling pathway GO:0019933 P:cAMP-mediated signaling GO:0030308 P:negative regulation of cell growth GO:0031138 P:negative regulation of conjugation with cellular fusion GO:0030836 P:positive regulation of actin filament depolymerization GO:0090141 P:positive regulation of mitochondrial fission GO:0046579 P:positive regulation of Ras protein signal transduction GO:0007265 P:Ras protein signal transduction GO:0030833 P:regulation of actin filament polymerization
KEGG	ago:AGOS_AFR061W -
Pfam	View protein in Pfam PF08603 CAP_C PF01213 CAP_N
PROSITE	View protein in PROSITE PS51329 C_CAP_COFACTOR_C PS01088 CAP_1 PS01089 CAP_2

Amino Acid Sequences

MLEANFSIQGYNLVKLLKRLEDATARLEDVTIYQEGYVQSKMGSAAGQTSMGSQVSAEGGAAAEAPAHMQEYEQLVDEWVRPLVGAGQQIDAAVGEASQQLLEGFAAQGTLLRAAALARKPEMGSEGFMRALGPLNERIMTLGALKDAQRQSPYFAYLSAVAEGAPAFGWIASETPVSLIGDFKDAAQFWTNRVLKEFREKDANAAEWVRLFLGTFDALRGYVKAHHATGPTYKSDGVDFMEAFEQVSGVVAAEPAAAAGAPPPPPPPPASVFQAPADGGSQGINAVFAELNQGENITRSLRKVDRSQQTHKNPELRAASSVPSSAGSRTPPPKPRKPTTLKTRKPPRKELVGSKWFVENYDGEADPIIIETNKDESVFIGRCNNIFIQLKGKVNAVTISESQHCNLLLDSSISGVDVIKSERFAIQVAQQIPQITIDKSDTGVIYLSKDSLQTELFTSSSTSINVNIPTGDDGDFEEHPIPEQLKHTFSNGRLNSAIFEHVA

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.2
2	0.24
3	0.29
4	0.26
5	0.27
6	0.28
7	0.31
8	0.34
9	0.36
10	0.36
11	0.34
12	0.31
13	0.28
14	0.27
15	0.21
16	0.16
17	0.17
18	0.13
19	0.11
20	0.1
21	0.13
22	0.14
23	0.16
24	0.16
25	0.13
26	0.12
27	0.13
28	0.14
29	0.11
30	0.11
31	0.09
32	0.11
33	0.11
34	0.12
35	0.11
36	0.11
37	0.12
38	0.12
39	0.11
40	0.09
41	0.08
42	0.08
43	0.08
44	0.07
45	0.05
46	0.05
47	0.05
48	0.06
49	0.04
50	0.04
51	0.04
52	0.04
53	0.05
54	0.06
55	0.06
56	0.05
57	0.08
58	0.11
59	0.12
60	0.13
61	0.12
62	0.12
63	0.14
64	0.15
65	0.14
66	0.11
67	0.1
68	0.09
69	0.09
70	0.11
71	0.12
72	0.14
73	0.14
74	0.14
75	0.14
76	0.14
77	0.14
78	0.11
79	0.09
80	0.06
81	0.05
82	0.05
83	0.05
84	0.05
85	0.05
86	0.05
87	0.04
88	0.05
89	0.05
90	0.05
91	0.05
92	0.04
93	0.04
94	0.04
95	0.06
96	0.06
97	0.07
98	0.06
99	0.06
100	0.06
101	0.07
102	0.12
103	0.13
104	0.15
105	0.16
106	0.17
107	0.18
108	0.18
109	0.2
110	0.16
111	0.16
112	0.16
113	0.16
114	0.15
115	0.15
116	0.14
117	0.12
118	0.14
119	0.13
120	0.13
121	0.13
122	0.15
123	0.15
124	0.15
125	0.15
126	0.13
127	0.12
128	0.11
129	0.09
130	0.08
131	0.09
132	0.1
133	0.16
134	0.17
135	0.19
136	0.21
137	0.22
138	0.25
139	0.25
140	0.27
141	0.2
142	0.19
143	0.18
144	0.16
145	0.17
146	0.13
147	0.11
148	0.08
149	0.08
150	0.08
151	0.07
152	0.05
153	0.04
154	0.03
155	0.03
156	0.04
157	0.04
158	0.04
159	0.05
160	0.05
161	0.05
162	0.05
163	0.06
164	0.06
165	0.06
166	0.06
167	0.06
168	0.08
169	0.08
170	0.08
171	0.09
172	0.09
173	0.1
174	0.13
175	0.13
176	0.13
177	0.23
178	0.24
179	0.23
180	0.26
181	0.27
182	0.25
183	0.35
184	0.37
185	0.29
186	0.35
187	0.35
188	0.35
189	0.36
190	0.35
191	0.26
192	0.24
193	0.22
194	0.15
195	0.15
196	0.12
197	0.08
198	0.07
199	0.05
200	0.06
201	0.06
202	0.05
203	0.05
204	0.05
205	0.06
206	0.06
207	0.06
208	0.06
209	0.08
210	0.11
211	0.12
212	0.13
213	0.15
214	0.15
215	0.17
216	0.2
217	0.19
218	0.18
219	0.17
220	0.17
221	0.15
222	0.15
223	0.14
224	0.11
225	0.1
226	0.09
227	0.09
228	0.09
229	0.08
230	0.08
231	0.07
232	0.05
233	0.04
234	0.04
235	0.03
236	0.03
237	0.03
238	0.03
239	0.03
240	0.03
241	0.03
242	0.02
243	0.02
244	0.02
245	0.02
246	0.03
247	0.04
248	0.05
249	0.06
250	0.07
251	0.09
252	0.1
253	0.12
254	0.14
255	0.16
256	0.18
257	0.22
258	0.22
259	0.23
260	0.22
261	0.22
262	0.19
263	0.16
264	0.13
265	0.09
266	0.08
267	0.06
268	0.05
269	0.04
270	0.04
271	0.04
272	0.03
273	0.04
274	0.04
275	0.03
276	0.06
277	0.05
278	0.06
279	0.06
280	0.06
281	0.06
282	0.06
283	0.08
284	0.08
285	0.09
286	0.09
287	0.15
288	0.18
289	0.22
290	0.28
291	0.36
292	0.43
293	0.5
294	0.57
295	0.61
296	0.67
297	0.71
298	0.7
299	0.67
300	0.58
301	0.58
302	0.54
303	0.45
304	0.39
305	0.32
306	0.28
307	0.22
308	0.22
309	0.15
310	0.13
311	0.12
312	0.1
313	0.11
314	0.12
315	0.17
316	0.22
317	0.29
318	0.38
319	0.46
320	0.55
321	0.62
322	0.67
323	0.72
324	0.75
325	0.78
326	0.8
327	0.82
328	0.81
329	0.82
330	0.87
331	0.86
332	0.86
333	0.86
334	0.81
335	0.8
336	0.8
337	0.79
338	0.78
339	0.76
340	0.69
341	0.6
342	0.56
343	0.46
344	0.4
345	0.32
346	0.22
347	0.16
348	0.18
349	0.17
350	0.14
351	0.14
352	0.13
353	0.11
354	0.1
355	0.08
356	0.05
357	0.05
358	0.06
359	0.09
360	0.09
361	0.09
362	0.09
363	0.09
364	0.15
365	0.16
366	0.16
367	0.19
368	0.19
369	0.2
370	0.22
371	0.22
372	0.22
373	0.23
374	0.23
375	0.24
376	0.28
377	0.31
378	0.3
379	0.32
380	0.26
381	0.25
382	0.26
383	0.21
384	0.2
385	0.18
386	0.2
387	0.21
388	0.22
389	0.21
390	0.21
391	0.2
392	0.17
393	0.16
394	0.13
395	0.11
396	0.1
397	0.1
398	0.09
399	0.08
400	0.08
401	0.08
402	0.07
403	0.07
404	0.07
405	0.09
406	0.1
407	0.1
408	0.12
409	0.12
410	0.13
411	0.13
412	0.14
413	0.16
414	0.22
415	0.23
416	0.23
417	0.24
418	0.24
419	0.23
420	0.25
421	0.23
422	0.16
423	0.17
424	0.18
425	0.17
426	0.17
427	0.18
428	0.15
429	0.14
430	0.15
431	0.13
432	0.13
433	0.13
434	0.13
435	0.12
436	0.13
437	0.13
438	0.14
439	0.14
440	0.13
441	0.14
442	0.15
443	0.15
444	0.14
445	0.15
446	0.15
447	0.15
448	0.15
449	0.14
450	0.14
451	0.18
452	0.18
453	0.17
454	0.16
455	0.16
456	0.16
457	0.17
458	0.15
459	0.12
460	0.13
461	0.16
462	0.16
463	0.17
464	0.18
465	0.16
466	0.17
467	0.2
468	0.2
469	0.19
470	0.23
471	0.25
472	0.27
473	0.29
474	0.32
475	0.36
476	0.38
477	0.46
478	0.42
479	0.44
480	0.41
481	0.4
482	0.37
483	0.32

Q754L1

3D AlphaFold-predicted Structure Viewer