Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N7BKP3

Protein Details
Accession A0A5N7BKP3    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
34-64VLEPSTKMRAKWRKKRVRRLKRKRRKMRARRBasic
NLS Segment(s)
PositionSequence
40-64KMRAKWRKKRVRRLKRKRRKMRARR
Subcellular Location(s) mito 24.5, cyto_mito 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007836  Ribosomal_L41  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF05162  Ribosomal_L41  
Amino Acid Sequences MPSRMLSQPRRTQEARPAAALHLSFNHLLIVAEVLEPSTKMRAKWRKKRVRRLKRKRRKMRARR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.57
3 0.5
4 0.45
5 0.38
6 0.38
7 0.33
8 0.24
9 0.15
10 0.15
11 0.13
12 0.12
13 0.11
14 0.08
15 0.08
16 0.07
17 0.06
18 0.04
19 0.04
20 0.04
21 0.04
22 0.04
23 0.04
24 0.05
25 0.09
26 0.1
27 0.11
28 0.22
29 0.32
30 0.43
31 0.54
32 0.65
33 0.72
34 0.81
35 0.92
36 0.93
37 0.94
38 0.95
39 0.96
40 0.96
41 0.97
42 0.97
43 0.97
44 0.97