Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N7BDF8

Protein Details
Accession A0A5N7BDF8   
Localization Confidence Medium
Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
17-38VLRYRDKCDAHRERKRKEKIELBasic
71-96NSQTANPSLKKKKRINHSSRLPNANGHydrophilic
NLS Segment(s)
PositionSequence
81-83KKK
Subcellular Location(s) nucl 17, mito_nucl 12.833, cyto_nucl 10.333, mito 7.5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MHICSCQDHRLWSSTYVLRYRDKCDAHRERKRKEKIELPNFYTAVLATWILITSTNMLGCAAANNNRDTNNSQTANPSLKKKKRINHSSRLPNANGSH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.37
3 0.36
4 0.37
5 0.4
6 0.41
7 0.44
8 0.47
9 0.47
10 0.46
11 0.52
12 0.59
13 0.63
14 0.7
15 0.75
16 0.75
17 0.82
18 0.87
19 0.83
20 0.79
21 0.77
22 0.77
23 0.79
24 0.76
25 0.7
26 0.65
27 0.58
28 0.5
29 0.41
30 0.3
31 0.2
32 0.14
33 0.1
34 0.05
35 0.04
36 0.04
37 0.04
38 0.04
39 0.04
40 0.05
41 0.05
42 0.05
43 0.05
44 0.05
45 0.05
46 0.05
47 0.06
48 0.07
49 0.11
50 0.13
51 0.15
52 0.16
53 0.17
54 0.2
55 0.22
56 0.26
57 0.28
58 0.28
59 0.27
60 0.29
61 0.32
62 0.36
63 0.37
64 0.41
65 0.45
66 0.51
67 0.61
68 0.66
69 0.7
70 0.75
71 0.82
72 0.82
73 0.82
74 0.85
75 0.86
76 0.86
77 0.85
78 0.76