Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N7BBN7

Protein Details
Accession A0A5N7BBN7    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
81-104SETQLDKRRHYRSPKPKPDDNTSEHydrophilic
NLS Segment(s)
Subcellular Location(s) E.R. 8, extr 7, golg 7, vacu 3
Family & Domain DBs
Amino Acid Sequences MKCLIVFFLLIYTVLVSSMPTTNNGAAFDTSNESPNTLIAACKGDWGCPPKPPVTDPGDPSNNQETPETPGEVEPEVHDASETQLDKRRHYRSPKPKPDDNTSEESSAQVPQEEPACKQWWDCGNLEFDYDK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.05
4 0.07
5 0.09
6 0.09
7 0.1
8 0.13
9 0.14
10 0.15
11 0.16
12 0.15
13 0.14
14 0.15
15 0.14
16 0.16
17 0.15
18 0.17
19 0.16
20 0.15
21 0.14
22 0.13
23 0.13
24 0.09
25 0.09
26 0.08
27 0.1
28 0.09
29 0.13
30 0.13
31 0.13
32 0.17
33 0.22
34 0.22
35 0.24
36 0.27
37 0.26
38 0.28
39 0.28
40 0.29
41 0.31
42 0.33
43 0.32
44 0.35
45 0.36
46 0.34
47 0.37
48 0.35
49 0.3
50 0.27
51 0.24
52 0.19
53 0.2
54 0.21
55 0.17
56 0.13
57 0.13
58 0.13
59 0.13
60 0.12
61 0.08
62 0.09
63 0.09
64 0.09
65 0.08
66 0.07
67 0.08
68 0.12
69 0.12
70 0.12
71 0.2
72 0.21
73 0.26
74 0.34
75 0.38
76 0.42
77 0.51
78 0.6
79 0.64
80 0.74
81 0.8
82 0.8
83 0.82
84 0.81
85 0.8
86 0.77
87 0.71
88 0.66
89 0.58
90 0.52
91 0.45
92 0.39
93 0.31
94 0.25
95 0.2
96 0.15
97 0.12
98 0.12
99 0.17
100 0.18
101 0.19
102 0.23
103 0.26
104 0.26
105 0.26
106 0.31
107 0.33
108 0.36
109 0.36
110 0.33
111 0.34
112 0.34