Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N7BM29

Protein Details
Accession A0A5N7BM29    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
26-47ELVWVNKRKRYLKKKRSALEFLHydrophilic
NLS Segment(s)
PositionSequence
32-41KRKRYLKKKR
Subcellular Location(s) plas 9, cyto 7, mito 3, pero 3, E.R. 2, golg 2, mito_nucl 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MRHDHELISSSTTLLAGILYYYHYVELVWVNKRKRYLKKKRSALEFLEAQVSSEWVGRDMSNCLLAVATRAGLFFVFFFLCLYYVC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.08
3 0.04
4 0.04
5 0.04
6 0.05
7 0.06
8 0.06
9 0.06
10 0.06
11 0.06
12 0.07
13 0.1
14 0.13
15 0.18
16 0.24
17 0.27
18 0.3
19 0.37
20 0.45
21 0.52
22 0.6
23 0.65
24 0.7
25 0.77
26 0.84
27 0.84
28 0.83
29 0.77
30 0.69
31 0.62
32 0.52
33 0.42
34 0.35
35 0.29
36 0.22
37 0.16
38 0.13
39 0.09
40 0.09
41 0.09
42 0.07
43 0.08
44 0.08
45 0.09
46 0.11
47 0.11
48 0.11
49 0.11
50 0.1
51 0.09
52 0.09
53 0.1
54 0.08
55 0.08
56 0.07
57 0.07
58 0.07
59 0.07
60 0.08
61 0.06
62 0.07
63 0.07
64 0.07
65 0.08
66 0.08