Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N7BIH1

Protein Details
Accession A0A5N7BIH1    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
138-160GPVRKILRRITKKPRFKRPDTSDBasic
NLS Segment(s)
PositionSequence
141-155RKILRRITKKPRFKR
Subcellular Location(s) cyto 18.5, cyto_nucl 11.5, nucl 3.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR035994  Nucleoside_phosphorylase_sf  
Gene Ontology GO:0003824  F:catalytic activity  
GO:0009116  P:nucleoside metabolic process  
Amino Acid Sequences MLPLIAAASHVAMIDTYLNTDESDGEDFREIPPEDITIAIFCTLSHEAVVVKYSLDEELRCRPMAIVPNIRLALMVGVGADIPNLPSRDIRLGDITVSVPQDNHPGVVQYDFGKYERDGFVLKEPFNKPLSILISADGPVRKILRRITKKPRFKRPDTSDNLFKEDFHHINKGADCAGCLASSAANLVPRDTREQKHPVVHRGLILSGSSVVNNPQNRHCLRRDYTNAICFETGAAGIMDEIPCLVVRGISNYADTHQQDEWHYYAAAAAASYCKAL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.08
4 0.09
5 0.09
6 0.09
7 0.1
8 0.1
9 0.1
10 0.13
11 0.12
12 0.13
13 0.14
14 0.14
15 0.14
16 0.21
17 0.2
18 0.18
19 0.19
20 0.18
21 0.17
22 0.17
23 0.17
24 0.1
25 0.1
26 0.09
27 0.08
28 0.07
29 0.11
30 0.12
31 0.12
32 0.11
33 0.11
34 0.11
35 0.12
36 0.13
37 0.09
38 0.07
39 0.07
40 0.08
41 0.09
42 0.1
43 0.1
44 0.13
45 0.2
46 0.23
47 0.23
48 0.23
49 0.22
50 0.25
51 0.32
52 0.36
53 0.36
54 0.35
55 0.39
56 0.39
57 0.38
58 0.34
59 0.26
60 0.19
61 0.11
62 0.09
63 0.04
64 0.04
65 0.04
66 0.04
67 0.03
68 0.03
69 0.04
70 0.07
71 0.08
72 0.09
73 0.09
74 0.12
75 0.16
76 0.17
77 0.17
78 0.16
79 0.16
80 0.16
81 0.16
82 0.15
83 0.12
84 0.12
85 0.11
86 0.09
87 0.09
88 0.13
89 0.12
90 0.12
91 0.1
92 0.1
93 0.11
94 0.11
95 0.11
96 0.09
97 0.1
98 0.1
99 0.11
100 0.11
101 0.11
102 0.14
103 0.13
104 0.13
105 0.13
106 0.13
107 0.19
108 0.21
109 0.21
110 0.24
111 0.25
112 0.27
113 0.28
114 0.27
115 0.21
116 0.21
117 0.22
118 0.17
119 0.16
120 0.13
121 0.12
122 0.13
123 0.14
124 0.1
125 0.09
126 0.08
127 0.1
128 0.1
129 0.13
130 0.18
131 0.27
132 0.35
133 0.44
134 0.54
135 0.63
136 0.73
137 0.79
138 0.85
139 0.83
140 0.81
141 0.83
142 0.8
143 0.8
144 0.77
145 0.74
146 0.7
147 0.63
148 0.61
149 0.5
150 0.42
151 0.35
152 0.33
153 0.3
154 0.24
155 0.25
156 0.22
157 0.24
158 0.25
159 0.23
160 0.18
161 0.16
162 0.14
163 0.12
164 0.12
165 0.09
166 0.08
167 0.08
168 0.06
169 0.06
170 0.07
171 0.06
172 0.09
173 0.09
174 0.1
175 0.11
176 0.13
177 0.2
178 0.25
179 0.26
180 0.3
181 0.37
182 0.41
183 0.47
184 0.51
185 0.51
186 0.51
187 0.49
188 0.44
189 0.39
190 0.35
191 0.27
192 0.22
193 0.15
194 0.12
195 0.1
196 0.09
197 0.08
198 0.1
199 0.15
200 0.19
201 0.21
202 0.24
203 0.32
204 0.35
205 0.41
206 0.43
207 0.46
208 0.46
209 0.53
210 0.56
211 0.56
212 0.59
213 0.59
214 0.57
215 0.5
216 0.46
217 0.36
218 0.3
219 0.22
220 0.15
221 0.1
222 0.08
223 0.06
224 0.06
225 0.07
226 0.07
227 0.06
228 0.06
229 0.05
230 0.05
231 0.07
232 0.06
233 0.07
234 0.07
235 0.12
236 0.14
237 0.15
238 0.17
239 0.16
240 0.18
241 0.24
242 0.24
243 0.24
244 0.23
245 0.25
246 0.25
247 0.29
248 0.29
249 0.24
250 0.23
251 0.19
252 0.18
253 0.16
254 0.14
255 0.1
256 0.09
257 0.08