Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N7AX38

Protein Details
Accession A0A5N7AX38   
Localization Confidence Medium
Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
6-34VSHPTTGSQRPAKKPRRVKGCYNCSQRRLHydrophilic
NLS Segment(s)
PositionSequence
19-19K
Subcellular Location(s) nucl 16.5, cyto_nucl 10.5, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences MLATDVSHPTTGSQRPAKKPRRVKGCYNCSQRRLNCDRGNPCQKCVKKGLHCSGLGVRYRFINGVAPLIRLSGAVNSLVQQFWRTTCRPTAGQVHRCR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.51
3 0.62
4 0.7
5 0.74
6 0.81
7 0.83
8 0.85
9 0.83
10 0.84
11 0.84
12 0.84
13 0.83
14 0.84
15 0.82
16 0.76
17 0.79
18 0.71
19 0.69
20 0.66
21 0.65
22 0.6
23 0.61
24 0.62
25 0.63
26 0.7
27 0.62
28 0.59
29 0.58
30 0.54
31 0.5
32 0.51
33 0.49
34 0.46
35 0.53
36 0.56
37 0.52
38 0.5
39 0.48
40 0.44
41 0.41
42 0.36
43 0.28
44 0.23
45 0.19
46 0.19
47 0.18
48 0.15
49 0.14
50 0.12
51 0.15
52 0.15
53 0.15
54 0.14
55 0.14
56 0.14
57 0.1
58 0.1
59 0.07
60 0.07
61 0.07
62 0.07
63 0.08
64 0.09
65 0.09
66 0.09
67 0.1
68 0.11
69 0.13
70 0.19
71 0.2
72 0.23
73 0.28
74 0.33
75 0.33
76 0.38
77 0.46
78 0.5