Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N7BFU5

Protein Details
Accession A0A5N7BFU5    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MGQRHNRRRTRPRSRNRSADLSPHydrophilic
NLS Segment(s)
PositionSequence
7-14RRRTRPRS
Subcellular Location(s) mito 18, nucl 6.5, cyto_nucl 5
Family & Domain DBs
Amino Acid Sequences MGQRHNRRRTRPRSRNRSADLSPVELPPYPVSHLHHETTPAACDSLNPISVPFAPTWHHGYTTWQKRDRTLRLEVEQCRLFGGEPGDDVGLCYRMLEYFGGLDYIDSSQSPRLLPG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.93
2 0.92
3 0.88
4 0.85
5 0.76
6 0.74
7 0.65
8 0.59
9 0.51
10 0.41
11 0.36
12 0.28
13 0.27
14 0.2
15 0.18
16 0.16
17 0.17
18 0.2
19 0.25
20 0.28
21 0.27
22 0.27
23 0.27
24 0.27
25 0.25
26 0.23
27 0.16
28 0.13
29 0.11
30 0.11
31 0.12
32 0.12
33 0.12
34 0.1
35 0.1
36 0.11
37 0.11
38 0.12
39 0.09
40 0.08
41 0.09
42 0.12
43 0.16
44 0.15
45 0.16
46 0.15
47 0.21
48 0.29
49 0.37
50 0.42
51 0.44
52 0.44
53 0.49
54 0.57
55 0.57
56 0.53
57 0.5
58 0.48
59 0.47
60 0.53
61 0.5
62 0.48
63 0.43
64 0.37
65 0.31
66 0.26
67 0.22
68 0.17
69 0.16
70 0.11
71 0.1
72 0.11
73 0.1
74 0.1
75 0.1
76 0.09
77 0.08
78 0.07
79 0.07
80 0.07
81 0.07
82 0.08
83 0.08
84 0.08
85 0.07
86 0.08
87 0.08
88 0.07
89 0.07
90 0.07
91 0.08
92 0.08
93 0.08
94 0.09
95 0.12
96 0.14