Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C5M3U3

Protein Details
Accession C5M3U3    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
99-120KEELTVKDKIKKKKEKGMMTIFHydrophilic
NLS Segment(s)
PositionSequence
107-114KIKKKKEK
Subcellular Location(s) mito 8, nucl 6, plas 5, cyto_mito 5, extr 4, cyto_nucl 4
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG ctp:CTRG_00732  -  
Amino Acid Sequences MFAVSISISISTGPCIYRICILLLTPLILYLYYSVSVFMYASHIVTQMKSEIRGLIKQDQQIITINHSYNNVYTKKYVYHVSSSIFVIEILRLHHQSRKEELTVKDKIKKKKEKGMMTIF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.12
3 0.13
4 0.15
5 0.16
6 0.16
7 0.15
8 0.15
9 0.16
10 0.14
11 0.14
12 0.11
13 0.1
14 0.09
15 0.08
16 0.08
17 0.06
18 0.06
19 0.06
20 0.06
21 0.07
22 0.06
23 0.07
24 0.07
25 0.06
26 0.07
27 0.07
28 0.07
29 0.07
30 0.08
31 0.09
32 0.09
33 0.09
34 0.1
35 0.1
36 0.1
37 0.1
38 0.12
39 0.13
40 0.15
41 0.17
42 0.2
43 0.23
44 0.24
45 0.26
46 0.24
47 0.23
48 0.24
49 0.22
50 0.19
51 0.18
52 0.17
53 0.15
54 0.16
55 0.15
56 0.13
57 0.18
58 0.17
59 0.15
60 0.17
61 0.17
62 0.18
63 0.2
64 0.23
65 0.21
66 0.23
67 0.23
68 0.24
69 0.24
70 0.23
71 0.21
72 0.16
73 0.14
74 0.1
75 0.09
76 0.08
77 0.09
78 0.12
79 0.14
80 0.15
81 0.2
82 0.24
83 0.28
84 0.33
85 0.36
86 0.37
87 0.41
88 0.45
89 0.48
90 0.51
91 0.53
92 0.56
93 0.59
94 0.65
95 0.69
96 0.75
97 0.77
98 0.8
99 0.83
100 0.84