Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N7AYV6

Protein Details
Accession A0A5N7AYV6   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
54-74TIWVMKARRRPVRRILRKVSIHydrophilic
NLS Segment(s)
PositionSequence
60-70ARRRPVRRILR
Subcellular Location(s) plas 10, nucl 5, cyto 5, cyto_nucl 5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MTHREDRRSLPHTPDERHHLSTGKYRLSVGCSRAGEGVIDLVTASVILLVLFLTIWVMKARRRPVRRILRKVSI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.56
3 0.57
4 0.55
5 0.5
6 0.43
7 0.39
8 0.43
9 0.43
10 0.37
11 0.32
12 0.3
13 0.29
14 0.32
15 0.33
16 0.26
17 0.27
18 0.25
19 0.25
20 0.24
21 0.23
22 0.17
23 0.13
24 0.12
25 0.05
26 0.05
27 0.04
28 0.03
29 0.03
30 0.03
31 0.02
32 0.02
33 0.02
34 0.02
35 0.02
36 0.02
37 0.02
38 0.02
39 0.02
40 0.03
41 0.03
42 0.04
43 0.06
44 0.09
45 0.12
46 0.2
47 0.3
48 0.4
49 0.47
50 0.54
51 0.62
52 0.72
53 0.8
54 0.83