FuNGI

A0A5N7APZ4

Protein Details

Accession

A0A5N7APZ4

Localization Confidence

Medium

Confidence Score

14.9

NoLS Segment(s)

Position	Sequence	Protein Nature
296-318	HDSRRHFRERSPRADRRNKGREL	Basic

NLS Segment(s)

Position	Sequence
205-218	RRRRFDGRELRRRR
300-315	RHFRERSPRADRRNKG

Subcellular Location(s)

nucl 19.5, cyto_nucl 13.5, cyto 6.5

Family & Domain DBs

InterPro	View protein in InterPro IPR019416 NCBP3
Gene Ontology	GO:0003729 F:mRNA binding GO:0000340 F:RNA 7-methylguanosine cap binding
Pfam	View protein in Pfam PF10309 NCBP3

Amino Acid Sequences

MEAAGVQQPPASNGDHAMDASMDIDMDLDLGPLPEAEPIEADSLGGTAPFADGAVDPQTSEAQYEKVHVRGVDELTTDNIKQFAMEHFTLEAPSRVEWIDDTSANLIYSSPEIGLQALSAFTQASEEEDTSELPALRLRSAKLLPSHPDSVLQVRSAVKTDRKKPRAHEASRFYLMHPEHDPRERLRREFDDRRRHGGGDDGDYRRRRFDGRELRRRRDRDGDELISANMYDDSGATSTDYPETGRGHDERGRRRDRDRELFPSDEGRPSGRLQNRSASPGRDTLVESGYSEHDRHDSRRHFRERSPRADRRNKGRELFPSSKSFGADADADSRELFPNKPATSYLKKELFPSKHSNHRRSDAIDAADETADLFSRRISVPLVDGSQDQRRNKNVELFPDSGESGVNIRGAAGPDQGFSIRGAANGLSIKGRGASVRELFPSKYNSNAGKELFSDKIEGRGGPRRRAEDMFS

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.18
2	0.18
3	0.17
4	0.16
5	0.14
6	0.12
7	0.11
8	0.09
9	0.07
10	0.05
11	0.06
12	0.05
13	0.05
14	0.05
15	0.05
16	0.05
17	0.05
18	0.06
19	0.05
20	0.06
21	0.07
22	0.08
23	0.08
24	0.08
25	0.09
26	0.11
27	0.11
28	0.1
29	0.08
30	0.08
31	0.08
32	0.07
33	0.05
34	0.04
35	0.04
36	0.04
37	0.04
38	0.04
39	0.05
40	0.07
41	0.1
42	0.09
43	0.09
44	0.11
45	0.12
46	0.12
47	0.13
48	0.12
49	0.12
50	0.13
51	0.17
52	0.19
53	0.19
54	0.22
55	0.21
56	0.22
57	0.24
58	0.25
59	0.23
60	0.21
61	0.2
62	0.19
63	0.22
64	0.2
65	0.16
66	0.15
67	0.13
68	0.12
69	0.13
70	0.13
71	0.17
72	0.17
73	0.17
74	0.18
75	0.18
76	0.19
77	0.19
78	0.18
79	0.12
80	0.12
81	0.13
82	0.12
83	0.12
84	0.12
85	0.14
86	0.15
87	0.14
88	0.15
89	0.15
90	0.15
91	0.15
92	0.14
93	0.11
94	0.09
95	0.09
96	0.09
97	0.07
98	0.07
99	0.07
100	0.07
101	0.07
102	0.06
103	0.06
104	0.05
105	0.05
106	0.05
107	0.05
108	0.04
109	0.05
110	0.05
111	0.07
112	0.08
113	0.08
114	0.09
115	0.1
116	0.1
117	0.1
118	0.12
119	0.1
120	0.09
121	0.11
122	0.11
123	0.13
124	0.14
125	0.14
126	0.18
127	0.19
128	0.24
129	0.25
130	0.29
131	0.31
132	0.35
133	0.36
134	0.31
135	0.32
136	0.29
137	0.29
138	0.26
139	0.22
140	0.19
141	0.18
142	0.18
143	0.19
144	0.22
145	0.26
146	0.32
147	0.42
148	0.5
149	0.56
150	0.6
151	0.63
152	0.7
153	0.73
154	0.71
155	0.71
156	0.66
157	0.66
158	0.65
159	0.61
160	0.5
161	0.46
162	0.4
163	0.34
164	0.3
165	0.28
166	0.26
167	0.3
168	0.32
169	0.29
170	0.39
171	0.39
172	0.39
173	0.41
174	0.44
175	0.49
176	0.57
177	0.63
178	0.64
179	0.64
180	0.68
181	0.64
182	0.58
183	0.49
184	0.45
185	0.37
186	0.31
187	0.33
188	0.29
189	0.34
190	0.36
191	0.37
192	0.32
193	0.32
194	0.29
195	0.26
196	0.34
197	0.39
198	0.47
199	0.57
200	0.64
201	0.71
202	0.77
203	0.77
204	0.71
205	0.7
206	0.63
207	0.59
208	0.58
209	0.51
210	0.43
211	0.4
212	0.35
213	0.25
214	0.21
215	0.14
216	0.07
217	0.05
218	0.04
219	0.03
220	0.04
221	0.04
222	0.04
223	0.04
224	0.05
225	0.05
226	0.06
227	0.06
228	0.06
229	0.08
230	0.09
231	0.09
232	0.12
233	0.12
234	0.15
235	0.2
236	0.26
237	0.33
238	0.41
239	0.47
240	0.48
241	0.53
242	0.58
243	0.62
244	0.64
245	0.61
246	0.59
247	0.57
248	0.55
249	0.5
250	0.45
251	0.38
252	0.31
253	0.27
254	0.2
255	0.18
256	0.18
257	0.24
258	0.26
259	0.29
260	0.29
261	0.35
262	0.35
263	0.39
264	0.4
265	0.34
266	0.31
267	0.29
268	0.28
269	0.22
270	0.22
271	0.18
272	0.17
273	0.15
274	0.13
275	0.12
276	0.13
277	0.14
278	0.13
279	0.12
280	0.14
281	0.16
282	0.19
283	0.27
284	0.34
285	0.4
286	0.49
287	0.57
288	0.57
289	0.62
290	0.7
291	0.69
292	0.71
293	0.74
294	0.73
295	0.75
296	0.81
297	0.81
298	0.81
299	0.82
300	0.78
301	0.72
302	0.69
303	0.66
304	0.65
305	0.63
306	0.56
307	0.52
308	0.48
309	0.45
310	0.4
311	0.33
312	0.23
313	0.2
314	0.17
315	0.13
316	0.14
317	0.13
318	0.13
319	0.13
320	0.14
321	0.14
322	0.15
323	0.14
324	0.14
325	0.21
326	0.21
327	0.22
328	0.23
329	0.28
330	0.34
331	0.38
332	0.43
333	0.42
334	0.42
335	0.46
336	0.53
337	0.5
338	0.49
339	0.53
340	0.51
341	0.56
342	0.65
343	0.68
344	0.66
345	0.67
346	0.65
347	0.59
348	0.58
349	0.52
350	0.44
351	0.38
352	0.32
353	0.28
354	0.23
355	0.19
356	0.14
357	0.1
358	0.08
359	0.08
360	0.07
361	0.06
362	0.09
363	0.1
364	0.1
365	0.12
366	0.12
367	0.14
368	0.17
369	0.17
370	0.16
371	0.17
372	0.2
373	0.27
374	0.34
375	0.36
376	0.4
377	0.44
378	0.48
379	0.51
380	0.56
381	0.52
382	0.53
383	0.55
384	0.5
385	0.46
386	0.43
387	0.39
388	0.29
389	0.25
390	0.18
391	0.13
392	0.12
393	0.11
394	0.08
395	0.09
396	0.11
397	0.12
398	0.13
399	0.15
400	0.14
401	0.13
402	0.15
403	0.15
404	0.14
405	0.13
406	0.14
407	0.11
408	0.11
409	0.12
410	0.11
411	0.13
412	0.14
413	0.15
414	0.13
415	0.13
416	0.13
417	0.13
418	0.14
419	0.13
420	0.15
421	0.21
422	0.23
423	0.26
424	0.3
425	0.32
426	0.33
427	0.36
428	0.4
429	0.35
430	0.36
431	0.4
432	0.41
433	0.43
434	0.47
435	0.44
436	0.39
437	0.4
438	0.39
439	0.35
440	0.3
441	0.29
442	0.24
443	0.28
444	0.28
445	0.27
446	0.28
447	0.36
448	0.42
449	0.47
450	0.53
451	0.53
452	0.57

A0A5N7APZ4

3D AlphaFold-predicted Structure Viewer