Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N6TJ44

Protein Details
Accession A0A5N6TJ44    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
91-110GEKVDFKRCQRTVKRELERAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 10, E.R. 5, mito_nucl 5, plas 3, extr 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MTVKHEGPQKKICSVSGWKYLFFCLPCYFFSLFPFCFFFPWAGSFGFFKKKVVGALGLVTAIDQNINPPCLFLVFFRDSLGTKMGRSAAEGEKVDFKRCQRTVKRELERAAAW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.48
3 0.49
4 0.46
5 0.42
6 0.41
7 0.41
8 0.39
9 0.31
10 0.28
11 0.22
12 0.22
13 0.21
14 0.25
15 0.25
16 0.21
17 0.23
18 0.24
19 0.22
20 0.22
21 0.24
22 0.19
23 0.18
24 0.19
25 0.17
26 0.13
27 0.14
28 0.13
29 0.11
30 0.12
31 0.12
32 0.14
33 0.19
34 0.18
35 0.17
36 0.17
37 0.18
38 0.17
39 0.17
40 0.16
41 0.1
42 0.1
43 0.1
44 0.08
45 0.07
46 0.06
47 0.05
48 0.04
49 0.04
50 0.03
51 0.05
52 0.06
53 0.08
54 0.08
55 0.08
56 0.08
57 0.09
58 0.09
59 0.08
60 0.13
61 0.14
62 0.15
63 0.15
64 0.16
65 0.16
66 0.17
67 0.2
68 0.13
69 0.11
70 0.13
71 0.15
72 0.14
73 0.15
74 0.18
75 0.18
76 0.23
77 0.23
78 0.23
79 0.29
80 0.31
81 0.34
82 0.34
83 0.35
84 0.4
85 0.44
86 0.53
87 0.54
88 0.63
89 0.69
90 0.76
91 0.81
92 0.79
93 0.78