Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C5MCA3

Protein Details
Accession C5MCA3   
Localization Confidence Medium
Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
85-110EADKPNNKKSEKKNDQNKKSKPNAYEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 23, cyto_nucl 15
Family & Domain DBs
InterPro View protein in InterPro  
IPR011107  PPI_Ypi1  
Gene Ontology GO:0005634  C:nucleus  
GO:0004865  F:protein serine/threonine phosphatase inhibitor activity  
GO:0032515  P:negative regulation of phosphoprotein phosphatase activity  
KEGG ctp:CTRG_03695  -  
Pfam View protein in Pfam  
PF07491  PPI_Ypi1  
Amino Acid Sequences MSQQQVPTDNRTVSQTITTTAPPVLRLEAGQQDRPRVTWDESVIDNENLNRKKTKICCIYHPTDEDGNHECDSDSDSSSDSSGDEADKPNNKKSEKKNDQNKKSKPNAYEVQPNYTNRSHVPRNT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.23
3 0.2
4 0.21
5 0.2
6 0.18
7 0.19
8 0.18
9 0.15
10 0.16
11 0.15
12 0.13
13 0.13
14 0.15
15 0.21
16 0.24
17 0.29
18 0.29
19 0.33
20 0.33
21 0.33
22 0.33
23 0.29
24 0.29
25 0.26
26 0.26
27 0.24
28 0.24
29 0.26
30 0.25
31 0.22
32 0.19
33 0.17
34 0.23
35 0.22
36 0.24
37 0.23
38 0.22
39 0.28
40 0.32
41 0.4
42 0.42
43 0.42
44 0.48
45 0.53
46 0.56
47 0.52
48 0.49
49 0.43
50 0.36
51 0.34
52 0.29
53 0.24
54 0.23
55 0.2
56 0.18
57 0.15
58 0.13
59 0.15
60 0.13
61 0.11
62 0.09
63 0.09
64 0.09
65 0.1
66 0.1
67 0.07
68 0.06
69 0.06
70 0.07
71 0.08
72 0.09
73 0.14
74 0.21
75 0.25
76 0.31
77 0.37
78 0.4
79 0.47
80 0.56
81 0.62
82 0.66
83 0.73
84 0.78
85 0.82
86 0.89
87 0.91
88 0.91
89 0.89
90 0.88
91 0.86
92 0.78
93 0.76
94 0.72
95 0.67
96 0.68
97 0.61
98 0.59
99 0.57
100 0.56
101 0.53
102 0.49
103 0.46
104 0.4
105 0.45