Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N6TI20

Protein Details
Accession A0A5N6TI20    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
30-60VLEHSTKMRAKWRKKRVRRLKRKRRKMRARRBasic
NLS Segment(s)
PositionSequence
36-60KMRAKWRKKRVRRLKRKRRKMRARR
Subcellular Location(s) mito 17.5, cyto_mito 9.5, nucl 5, plas 2, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR007836  Ribosomal_L41  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF05162  Ribosomal_L41  
Amino Acid Sequences MLSQPQRTQEAAPRLAFHLSFNHLFILAEVLEHSTKMRAKWRKKRVRRLKRKRRKMRARR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.36
3 0.32
4 0.25
5 0.2
6 0.19
7 0.19
8 0.18
9 0.17
10 0.15
11 0.14
12 0.13
13 0.11
14 0.07
15 0.06
16 0.05
17 0.06
18 0.06
19 0.06
20 0.06
21 0.08
22 0.1
23 0.12
24 0.22
25 0.3
26 0.41
27 0.52
28 0.63
29 0.71
30 0.81
31 0.9
32 0.92
33 0.94
34 0.95
35 0.96
36 0.96
37 0.96
38 0.97
39 0.97
40 0.97