Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N6TV17

Protein Details
Accession A0A5N6TV17    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
183-209SVKGGPSSSKNKKKSNTNKDKNDDDDDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 24.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR015418  Eaf6  
Gene Ontology GO:0035267  C:NuA4 histone acetyltransferase complex  
GO:0005634  C:nucleus  
GO:0016740  F:transferase activity  
GO:0006325  P:chromatin organization  
GO:0006281  P:DNA repair  
GO:0016573  P:histone acetylation  
Pfam View protein in Pfam  
PF09340  NuA4  
Amino Acid Sequences MTESAPPPSAPNTAAMPSGPTTANQSSASNNNNSNGSSSGQGGANRGLPYYEKLRRELRDTLQRKRMMDKSMAALEDQIFRFEQSYLEETTAGNIIKGFDNYIKGSSSGAGGAGSLALSGGVGGARRKAQVTDADRVFSRSSASFLRDSTPSSVQTTPSHAPTPTSVNGSSGKPNGDSSAPGSVKGGPSSSKNKKKSNTNKDKNDDDDDAGDKPPSKRLKISYARD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.19
3 0.19
4 0.18
5 0.2
6 0.17
7 0.15
8 0.2
9 0.2
10 0.23
11 0.22
12 0.22
13 0.23
14 0.29
15 0.32
16 0.3
17 0.31
18 0.3
19 0.3
20 0.29
21 0.27
22 0.23
23 0.21
24 0.18
25 0.17
26 0.16
27 0.17
28 0.17
29 0.17
30 0.17
31 0.19
32 0.18
33 0.17
34 0.16
35 0.15
36 0.17
37 0.24
38 0.3
39 0.28
40 0.33
41 0.4
42 0.43
43 0.47
44 0.5
45 0.49
46 0.53
47 0.57
48 0.61
49 0.62
50 0.64
51 0.6
52 0.6
53 0.58
54 0.51
55 0.48
56 0.42
57 0.37
58 0.35
59 0.34
60 0.27
61 0.23
62 0.19
63 0.2
64 0.17
65 0.15
66 0.12
67 0.12
68 0.13
69 0.12
70 0.11
71 0.1
72 0.12
73 0.12
74 0.12
75 0.12
76 0.11
77 0.11
78 0.13
79 0.1
80 0.08
81 0.07
82 0.08
83 0.08
84 0.08
85 0.08
86 0.07
87 0.1
88 0.1
89 0.11
90 0.11
91 0.1
92 0.1
93 0.1
94 0.09
95 0.07
96 0.06
97 0.05
98 0.04
99 0.04
100 0.03
101 0.03
102 0.02
103 0.02
104 0.02
105 0.02
106 0.02
107 0.02
108 0.02
109 0.03
110 0.03
111 0.05
112 0.06
113 0.07
114 0.08
115 0.08
116 0.1
117 0.17
118 0.21
119 0.27
120 0.26
121 0.27
122 0.27
123 0.29
124 0.27
125 0.19
126 0.17
127 0.11
128 0.13
129 0.13
130 0.16
131 0.15
132 0.15
133 0.17
134 0.16
135 0.18
136 0.19
137 0.2
138 0.19
139 0.22
140 0.22
141 0.22
142 0.23
143 0.27
144 0.25
145 0.26
146 0.26
147 0.23
148 0.23
149 0.22
150 0.26
151 0.22
152 0.23
153 0.21
154 0.21
155 0.23
156 0.24
157 0.26
158 0.23
159 0.22
160 0.2
161 0.2
162 0.2
163 0.18
164 0.18
165 0.16
166 0.23
167 0.22
168 0.21
169 0.22
170 0.22
171 0.23
172 0.22
173 0.21
174 0.15
175 0.2
176 0.3
177 0.4
178 0.48
179 0.55
180 0.62
181 0.69
182 0.78
183 0.83
184 0.85
185 0.86
186 0.86
187 0.89
188 0.87
189 0.86
190 0.81
191 0.76
192 0.68
193 0.59
194 0.51
195 0.43
196 0.37
197 0.32
198 0.28
199 0.26
200 0.24
201 0.3
202 0.34
203 0.37
204 0.42
205 0.47
206 0.55