Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6TFC8

Protein Details
Accession A0A5N6TFC8    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
1-30MVKPLTFKGDKPKKPKKRSAPYPSSKPTRTHydrophilic
NLS Segment(s)
PositionSequence
9-20GDKPKKPKKRSA
Subcellular Location(s) cyto 15.5, cyto_nucl 12, nucl 7.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR010414  FRG1  
Pfam View protein in Pfam  
PF06229  FRG1  
Amino Acid Sequences MVKPLTFKGDKPKKPKKRSAPYPSSKPTRTESSAAPEESNTEDQSWVSADAPTDIAGPVIIVLPSDPPTCIASDANGKVFASGIENLIEGDPGTAEPHDVRQVWVATRVAGTDGISFKGHHG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.91
3 0.9
4 0.91
5 0.93
6 0.94
7 0.93
8 0.91
9 0.91
10 0.89
11 0.86
12 0.78
13 0.7
14 0.65
15 0.61
16 0.55
17 0.48
18 0.42
19 0.41
20 0.42
21 0.39
22 0.35
23 0.27
24 0.25
25 0.25
26 0.25
27 0.18
28 0.14
29 0.13
30 0.12
31 0.13
32 0.12
33 0.09
34 0.08
35 0.07
36 0.07
37 0.07
38 0.07
39 0.07
40 0.07
41 0.06
42 0.05
43 0.05
44 0.04
45 0.04
46 0.04
47 0.03
48 0.03
49 0.03
50 0.04
51 0.06
52 0.06
53 0.06
54 0.07
55 0.08
56 0.09
57 0.1
58 0.09
59 0.09
60 0.14
61 0.15
62 0.15
63 0.15
64 0.14
65 0.13
66 0.13
67 0.12
68 0.09
69 0.08
70 0.08
71 0.08
72 0.08
73 0.08
74 0.08
75 0.08
76 0.06
77 0.05
78 0.05
79 0.05
80 0.06
81 0.05
82 0.07
83 0.07
84 0.1
85 0.14
86 0.14
87 0.15
88 0.18
89 0.2
90 0.2
91 0.24
92 0.22
93 0.19
94 0.19
95 0.18
96 0.15
97 0.14
98 0.14
99 0.13
100 0.14
101 0.15
102 0.16