Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6U2R8

Protein Details
Accession A0A5N6U2R8    Localization Confidence Low Confidence Score 7.6
NoLS Segment(s)
PositionSequenceProtein Nature
82-103RRKNRVYIICSKNPKHKQRQGKBasic
NLS Segment(s)
Subcellular Location(s) mito 17, nucl 7, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR000473  Ribosomal_L36  
IPR035977  Ribosomal_L36_sp  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00444  Ribosomal_L36  
PROSITE View protein in PROSITE  
PS00828  RIBOSOMAL_L36  
Amino Acid Sequences MFPLRNPTNLLRFIRNPIPNVLSRQFTRLAGLGLSNGMAKGLFRPVASKETVTTSVRQLDQVRGMKTRSSVKRLCDGCKPVRRKNRVYIICSKNPKHKQRQGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.51
3 0.47
4 0.44
5 0.45
6 0.41
7 0.44
8 0.41
9 0.37
10 0.34
11 0.35
12 0.32
13 0.28
14 0.27
15 0.22
16 0.19
17 0.15
18 0.14
19 0.11
20 0.08
21 0.08
22 0.07
23 0.05
24 0.05
25 0.04
26 0.04
27 0.05
28 0.06
29 0.07
30 0.07
31 0.09
32 0.11
33 0.14
34 0.15
35 0.14
36 0.13
37 0.15
38 0.19
39 0.18
40 0.17
41 0.16
42 0.18
43 0.18
44 0.2
45 0.19
46 0.18
47 0.24
48 0.27
49 0.27
50 0.26
51 0.27
52 0.26
53 0.28
54 0.35
55 0.33
56 0.37
57 0.39
58 0.4
59 0.48
60 0.5
61 0.5
62 0.49
63 0.51
64 0.54
65 0.59
66 0.64
67 0.65
68 0.72
69 0.77
70 0.76
71 0.79
72 0.8
73 0.78
74 0.77
75 0.78
76 0.76
77 0.77
78 0.79
79 0.75
80 0.75
81 0.77
82 0.81
83 0.82