Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6TX91

Protein Details
Accession A0A5N6TX91   
Localization Confidence High
Confidence Score 16.9
NoLS Segment(s)
PositionSequenceProtein Nature
51-70GNDWRRKSRSTDSRKRSRVEBasic
120-148QRRLEIKEEKRQKREPKPRKRTRDSMESABasic
156-175MTTMSRKKRVKPATSRTSLDHydrophilic
NLS Segment(s)
PositionSequence
126-142KEEKRQKREPKPRKRTR
Subcellular Location(s) nucl 18.5, cyto_nucl 12.333, mito_nucl 12.166, mito 4.5
Family & Domain DBs
Amino Acid Sequences MSSHIRMLNMVQKGVTRDDATFNLVSTMIEKTNRMITQFGVLKKQLQESSGNDWRRKSRSTDSRKRSRVESMDVESDVPVGAVQKPKRQRSDMLVPGHDEDVRNVTPVALETEDISEEVQRRLEIKEEKRQKREPKPRKRTRDSMESAGSPSSAGMTTMSRKKRVKPATSRTSLDGLRSQKNPGSFASEPGDQEQMGRPKRQKRLSGAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.28
3 0.23
4 0.22
5 0.25
6 0.26
7 0.27
8 0.25
9 0.22
10 0.19
11 0.17
12 0.16
13 0.13
14 0.14
15 0.12
16 0.14
17 0.14
18 0.15
19 0.22
20 0.23
21 0.23
22 0.22
23 0.2
24 0.26
25 0.31
26 0.31
27 0.29
28 0.29
29 0.32
30 0.33
31 0.37
32 0.31
33 0.28
34 0.3
35 0.29
36 0.36
37 0.4
38 0.44
39 0.42
40 0.44
41 0.49
42 0.49
43 0.49
44 0.46
45 0.49
46 0.53
47 0.61
48 0.68
49 0.72
50 0.78
51 0.81
52 0.77
53 0.71
54 0.68
55 0.62
56 0.57
57 0.52
58 0.45
59 0.41
60 0.38
61 0.35
62 0.26
63 0.22
64 0.15
65 0.1
66 0.06
67 0.05
68 0.07
69 0.13
70 0.15
71 0.21
72 0.3
73 0.37
74 0.42
75 0.44
76 0.45
77 0.46
78 0.53
79 0.54
80 0.5
81 0.44
82 0.4
83 0.38
84 0.35
85 0.29
86 0.19
87 0.13
88 0.12
89 0.11
90 0.11
91 0.1
92 0.09
93 0.08
94 0.08
95 0.09
96 0.06
97 0.06
98 0.06
99 0.06
100 0.06
101 0.07
102 0.06
103 0.06
104 0.07
105 0.08
106 0.08
107 0.08
108 0.09
109 0.1
110 0.15
111 0.22
112 0.26
113 0.35
114 0.46
115 0.53
116 0.6
117 0.68
118 0.73
119 0.76
120 0.82
121 0.83
122 0.84
123 0.88
124 0.91
125 0.93
126 0.91
127 0.9
128 0.85
129 0.85
130 0.79
131 0.74
132 0.66
133 0.56
134 0.49
135 0.39
136 0.32
137 0.22
138 0.16
139 0.1
140 0.07
141 0.06
142 0.06
143 0.08
144 0.14
145 0.22
146 0.26
147 0.34
148 0.38
149 0.45
150 0.54
151 0.62
152 0.67
153 0.7
154 0.76
155 0.78
156 0.81
157 0.76
158 0.69
159 0.64
160 0.55
161 0.48
162 0.44
163 0.39
164 0.39
165 0.38
166 0.39
167 0.37
168 0.38
169 0.37
170 0.32
171 0.34
172 0.29
173 0.31
174 0.32
175 0.31
176 0.3
177 0.3
178 0.31
179 0.22
180 0.23
181 0.27
182 0.31
183 0.34
184 0.41
185 0.47
186 0.55
187 0.65
188 0.73
189 0.74