Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N6U5D9

Protein Details
Accession A0A5N6U5D9    Localization Confidence High Confidence Score 20
NoLS Segment(s)
PositionSequenceProtein Nature
16-45KGSKVSDGRIEKKKKKKSKKEDKHESLDAEBasic
NLS Segment(s)
PositionSequence
12-37KLKLKGSKVSDGRIEKKKKKKSKKED
82-94RRKRLQERLKREG
Subcellular Location(s) nucl 27
Family & Domain DBs
InterPro View protein in InterPro  
IPR013865  FAM32A  
Pfam View protein in Pfam  
PF08555  FAM32A  
Amino Acid Sequences MPGDEYSIGGGKLKLKGSKVSDGRIEKKKKKKSKKEDKHESLDAENRPSEDVNKEVSRDGGVGGNSNDEGKTEAERKYEEMRRKRLQERLKREGVKTHKERVEELNKYLSRLSEHHDMPKIGPG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.27
3 0.34
4 0.37
5 0.46
6 0.46
7 0.46
8 0.49
9 0.53
10 0.59
11 0.61
12 0.67
13 0.67
14 0.74
15 0.8
16 0.83
17 0.86
18 0.9
19 0.91
20 0.93
21 0.94
22 0.95
23 0.96
24 0.93
25 0.89
26 0.81
27 0.72
28 0.65
29 0.6
30 0.5
31 0.41
32 0.34
33 0.26
34 0.23
35 0.21
36 0.19
37 0.14
38 0.14
39 0.16
40 0.16
41 0.17
42 0.16
43 0.16
44 0.14
45 0.13
46 0.12
47 0.09
48 0.08
49 0.08
50 0.08
51 0.08
52 0.08
53 0.08
54 0.07
55 0.06
56 0.07
57 0.07
58 0.09
59 0.12
60 0.13
61 0.15
62 0.16
63 0.19
64 0.25
65 0.31
66 0.38
67 0.43
68 0.51
69 0.57
70 0.64
71 0.67
72 0.69
73 0.73
74 0.74
75 0.75
76 0.74
77 0.76
78 0.73
79 0.69
80 0.69
81 0.67
82 0.67
83 0.64
84 0.64
85 0.59
86 0.56
87 0.57
88 0.57
89 0.58
90 0.52
91 0.49
92 0.49
93 0.46
94 0.46
95 0.44
96 0.37
97 0.3
98 0.28
99 0.31
100 0.3
101 0.32
102 0.38
103 0.42
104 0.42