Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6U0U8

Protein Details
Accession A0A5N6U0U8   
Localization Confidence High
Confidence Score 17.3
NoLS Segment(s)
PositionSequenceProtein Nature
189-222GAEPGKKRTAKQKETPNKKPRTRQDSKAEREQGEBasic
NLS Segment(s)
PositionSequence
114-118KKKKD
134-137KKKR
193-211GKKRTAKQKETPNKKPRTR
Subcellular Location(s) nucl 19.5, cyto_nucl 12.5, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MTQQDKYTDPDLREEIKEEIKQSDKGGKPGQWSARKAQFTAAEYKKRGGDYTTSKEEGEGRDESQRSLEKWGEEEWQTKEGSGTARMEDGSRKRYLPARAWEKMSEREREETDKKKKDESREGKQFVGNTEVAKKKRKEVQGEDGGESEDVNVDGKEGEGEDENDQDEELQDGEAEDQDKEQGDEDGEGAEPGKKRTAKQKETPNKKPRTRQDSKAEREQGEQAQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.35
3 0.36
4 0.37
5 0.34
6 0.35
7 0.35
8 0.35
9 0.36
10 0.41
11 0.38
12 0.42
13 0.46
14 0.43
15 0.44
16 0.5
17 0.57
18 0.55
19 0.56
20 0.57
21 0.6
22 0.59
23 0.54
24 0.52
25 0.47
26 0.42
27 0.49
28 0.48
29 0.47
30 0.46
31 0.49
32 0.46
33 0.42
34 0.4
35 0.33
36 0.33
37 0.33
38 0.39
39 0.42
40 0.4
41 0.39
42 0.38
43 0.39
44 0.33
45 0.29
46 0.23
47 0.19
48 0.24
49 0.24
50 0.24
51 0.25
52 0.26
53 0.23
54 0.25
55 0.26
56 0.2
57 0.21
58 0.22
59 0.22
60 0.22
61 0.24
62 0.22
63 0.22
64 0.21
65 0.2
66 0.18
67 0.16
68 0.16
69 0.15
70 0.13
71 0.11
72 0.12
73 0.12
74 0.13
75 0.17
76 0.19
77 0.21
78 0.21
79 0.21
80 0.23
81 0.29
82 0.33
83 0.34
84 0.4
85 0.43
86 0.44
87 0.46
88 0.46
89 0.44
90 0.47
91 0.44
92 0.39
93 0.34
94 0.34
95 0.33
96 0.37
97 0.39
98 0.41
99 0.46
100 0.5
101 0.49
102 0.54
103 0.57
104 0.58
105 0.64
106 0.63
107 0.63
108 0.65
109 0.66
110 0.59
111 0.56
112 0.5
113 0.4
114 0.35
115 0.26
116 0.17
117 0.2
118 0.25
119 0.27
120 0.34
121 0.34
122 0.37
123 0.43
124 0.5
125 0.52
126 0.54
127 0.6
128 0.61
129 0.62
130 0.56
131 0.49
132 0.42
133 0.34
134 0.26
135 0.17
136 0.08
137 0.06
138 0.05
139 0.05
140 0.04
141 0.04
142 0.05
143 0.05
144 0.05
145 0.05
146 0.06
147 0.08
148 0.08
149 0.09
150 0.1
151 0.1
152 0.09
153 0.08
154 0.08
155 0.07
156 0.06
157 0.05
158 0.05
159 0.05
160 0.06
161 0.07
162 0.07
163 0.07
164 0.07
165 0.08
166 0.09
167 0.09
168 0.09
169 0.09
170 0.09
171 0.09
172 0.09
173 0.09
174 0.08
175 0.08
176 0.08
177 0.11
178 0.12
179 0.13
180 0.2
181 0.23
182 0.26
183 0.37
184 0.48
185 0.53
186 0.61
187 0.7
188 0.74
189 0.82
190 0.9
191 0.89
192 0.89
193 0.89
194 0.91
195 0.91
196 0.9
197 0.88
198 0.86
199 0.87
200 0.87
201 0.85
202 0.85
203 0.82
204 0.74
205 0.69