Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6U8Z7

Protein Details
Accession A0A5N6U8Z7    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
24-52VMEPKEKKIKKEKEKKKTQRKYKDADQDLBasic
NLS Segment(s)
PositionSequence
28-60KEKKIKKEKEKKKTQRKYKDADQDLGRKKKYRP
Subcellular Location(s) mito 22, mito_nucl 13.333, cyto_mito 11.833
Family & Domain DBs
Amino Acid Sequences MWRMIPQTHWLSFSLHSFSQLLSVMEPKEKKIKKEKEKKKTQRKYKDADQDLGRKKKYRPEANKPSLVAMLVYPYCFRMCPFNHLHWLCNILVPR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.21
3 0.21
4 0.2
5 0.19
6 0.18
7 0.18
8 0.15
9 0.11
10 0.14
11 0.13
12 0.18
13 0.19
14 0.19
15 0.28
16 0.3
17 0.37
18 0.45
19 0.54
20 0.6
21 0.71
22 0.79
23 0.8
24 0.88
25 0.92
26 0.93
27 0.93
28 0.93
29 0.93
30 0.9
31 0.86
32 0.84
33 0.83
34 0.75
35 0.69
36 0.62
37 0.6
38 0.61
39 0.6
40 0.54
41 0.48
42 0.47
43 0.5
44 0.55
45 0.57
46 0.59
47 0.63
48 0.72
49 0.75
50 0.78
51 0.7
52 0.62
53 0.52
54 0.42
55 0.31
56 0.2
57 0.16
58 0.12
59 0.12
60 0.1
61 0.11
62 0.12
63 0.12
64 0.13
65 0.17
66 0.19
67 0.26
68 0.31
69 0.35
70 0.45
71 0.46
72 0.47
73 0.41
74 0.43
75 0.36