Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6TXB9

Protein Details
Accession A0A5N6TXB9    Localization Confidence Low Confidence Score 7.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MVPGQKATKARHNRRSRRLWTRGTTQHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, nucl 7.5, cyto_nucl 6.5, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MVPGQKATKARHNRRSRRLWTRGTTQAPQCNSPAPFSPLPVVSWLFSTLLSSVVSTLPILAQNLSDSSAGRFVRLLICPFTSKTTDLVRVSHNSNSPHQILLLTS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.91
3 0.91
4 0.9
5 0.89
6 0.87
7 0.82
8 0.79
9 0.78
10 0.73
11 0.69
12 0.65
13 0.62
14 0.56
15 0.52
16 0.45
17 0.41
18 0.36
19 0.32
20 0.28
21 0.27
22 0.25
23 0.24
24 0.24
25 0.2
26 0.19
27 0.19
28 0.17
29 0.12
30 0.12
31 0.12
32 0.1
33 0.09
34 0.09
35 0.07
36 0.07
37 0.07
38 0.06
39 0.06
40 0.06
41 0.06
42 0.05
43 0.05
44 0.04
45 0.05
46 0.05
47 0.05
48 0.05
49 0.05
50 0.06
51 0.07
52 0.07
53 0.07
54 0.07
55 0.13
56 0.12
57 0.12
58 0.12
59 0.12
60 0.15
61 0.17
62 0.18
63 0.15
64 0.17
65 0.19
66 0.2
67 0.22
68 0.21
69 0.2
70 0.22
71 0.24
72 0.29
73 0.29
74 0.3
75 0.31
76 0.33
77 0.35
78 0.36
79 0.37
80 0.34
81 0.37
82 0.41
83 0.38
84 0.35
85 0.32