Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6TKC1

Protein Details
Accession A0A5N6TKC1   
Localization Confidence High
Confidence Score 18.3
NoLS Segment(s)
PositionSequenceProtein Nature
232-251LIHKTVKQRVRRFCHRCNTTHydrophilic
257-283TECHNCNHTRCKKCPRDPPKLDKYPDGHydrophilic
288-315AEPPKEPPVRTWRKPRQRVRYTCHACLTHydrophilic
329-354QERGPQTLRDPPKKHKPEPDPEIVRRBasic
NLS Segment(s)
PositionSequence
207-217PVGRQPKPKPK
Subcellular Location(s) nucl 19.5, cyto_nucl 12.5, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MSTKGTKQPSEKDGKEGKEGKQGFSKYVGRMRTVSMKTVMRKSSSIKSVSGSTSKDKASVSEPTKSALPEDAVPPNTTASEVATSATAITPAQDAATTSAQQSTVFNHWGAIQEEKARALFAKYGLTLEPGEWRTTTDTAVQRVVKPIRMRVRRTCHRCQTTFGPDKLCTNCQHVRCTKCPRYPPAKTQENTETALQTILTGKGKEPVGRQPKPKPKAAPLTIPSRTGGQDLIHKTVKQRVRRFCHRCNTTFDPDATECHNCNHTRCKKCPRDPPKLDKYPDGYPGDAEPPKEPPVRTWRKPRQRVRYTCHACLTMFQLKEPICSNCGQERGPQTLRDPPKKHKPEPDPEIVRRVEERLAEVTISSI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.66
3 0.64
4 0.59
5 0.59
6 0.59
7 0.53
8 0.54
9 0.52
10 0.44
11 0.46
12 0.47
13 0.43
14 0.48
15 0.47
16 0.42
17 0.42
18 0.44
19 0.46
20 0.43
21 0.41
22 0.4
23 0.43
24 0.46
25 0.52
26 0.53
27 0.46
28 0.47
29 0.48
30 0.51
31 0.51
32 0.48
33 0.41
34 0.4
35 0.4
36 0.41
37 0.4
38 0.35
39 0.34
40 0.35
41 0.34
42 0.34
43 0.31
44 0.29
45 0.28
46 0.34
47 0.32
48 0.34
49 0.34
50 0.33
51 0.35
52 0.33
53 0.31
54 0.24
55 0.22
56 0.17
57 0.21
58 0.24
59 0.24
60 0.24
61 0.24
62 0.22
63 0.2
64 0.19
65 0.15
66 0.11
67 0.11
68 0.1
69 0.1
70 0.09
71 0.09
72 0.09
73 0.08
74 0.07
75 0.05
76 0.06
77 0.06
78 0.06
79 0.06
80 0.06
81 0.06
82 0.09
83 0.11
84 0.11
85 0.11
86 0.12
87 0.13
88 0.13
89 0.13
90 0.13
91 0.15
92 0.16
93 0.15
94 0.15
95 0.15
96 0.18
97 0.18
98 0.17
99 0.15
100 0.16
101 0.17
102 0.18
103 0.17
104 0.14
105 0.13
106 0.13
107 0.13
108 0.11
109 0.12
110 0.11
111 0.12
112 0.12
113 0.13
114 0.12
115 0.11
116 0.15
117 0.14
118 0.15
119 0.14
120 0.15
121 0.16
122 0.17
123 0.17
124 0.18
125 0.2
126 0.21
127 0.25
128 0.26
129 0.23
130 0.29
131 0.3
132 0.29
133 0.28
134 0.33
135 0.39
136 0.45
137 0.5
138 0.53
139 0.61
140 0.67
141 0.73
142 0.75
143 0.75
144 0.75
145 0.71
146 0.66
147 0.63
148 0.63
149 0.62
150 0.55
151 0.48
152 0.41
153 0.44
154 0.42
155 0.38
156 0.3
157 0.29
158 0.33
159 0.32
160 0.38
161 0.4
162 0.42
163 0.46
164 0.55
165 0.56
166 0.57
167 0.6
168 0.62
169 0.65
170 0.66
171 0.66
172 0.65
173 0.66
174 0.6
175 0.58
176 0.56
177 0.49
178 0.45
179 0.38
180 0.29
181 0.21
182 0.2
183 0.15
184 0.1
185 0.08
186 0.08
187 0.09
188 0.09
189 0.09
190 0.13
191 0.14
192 0.17
193 0.18
194 0.25
195 0.34
196 0.39
197 0.45
198 0.51
199 0.61
200 0.63
201 0.67
202 0.63
203 0.61
204 0.65
205 0.62
206 0.6
207 0.53
208 0.57
209 0.52
210 0.48
211 0.41
212 0.33
213 0.3
214 0.23
215 0.2
216 0.13
217 0.18
218 0.2
219 0.24
220 0.24
221 0.24
222 0.25
223 0.32
224 0.37
225 0.4
226 0.46
227 0.52
228 0.59
229 0.69
230 0.76
231 0.77
232 0.81
233 0.79
234 0.74
235 0.72
236 0.71
237 0.66
238 0.61
239 0.52
240 0.47
241 0.4
242 0.39
243 0.34
244 0.29
245 0.24
246 0.23
247 0.28
248 0.25
249 0.28
250 0.37
251 0.43
252 0.49
253 0.57
254 0.65
255 0.7
256 0.78
257 0.85
258 0.84
259 0.86
260 0.87
261 0.89
262 0.88
263 0.87
264 0.81
265 0.76
266 0.7
267 0.63
268 0.61
269 0.54
270 0.44
271 0.35
272 0.34
273 0.35
274 0.32
275 0.29
276 0.22
277 0.23
278 0.28
279 0.32
280 0.3
281 0.3
282 0.4
283 0.48
284 0.55
285 0.63
286 0.68
287 0.75
288 0.85
289 0.89
290 0.89
291 0.9
292 0.92
293 0.89
294 0.89
295 0.86
296 0.82
297 0.76
298 0.67
299 0.56
300 0.48
301 0.47
302 0.43
303 0.35
304 0.29
305 0.31
306 0.29
307 0.31
308 0.33
309 0.29
310 0.24
311 0.25
312 0.29
313 0.29
314 0.33
315 0.31
316 0.34
317 0.36
318 0.42
319 0.43
320 0.42
321 0.4
322 0.46
323 0.55
324 0.59
325 0.6
326 0.62
327 0.7
328 0.77
329 0.82
330 0.83
331 0.83
332 0.83
333 0.85
334 0.86
335 0.84
336 0.79
337 0.78
338 0.69
339 0.62
340 0.54
341 0.49
342 0.42
343 0.34
344 0.33
345 0.28
346 0.28
347 0.24