Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C5MAU7

Protein Details
Accession C5MAU7    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
88-120ALSVLRKRRLKMKKHKYKKRRKAQRALRKRLGKBasic
NLS Segment(s)
PositionSequence
93-120RKRRLKMKKHKYKKRRKAQRALRKRLGK
Subcellular Location(s) mito 18.5, mito_nucl 13, nucl 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013177  COX24_C  
KEGG ctp:CTRG_03189  -  
Pfam View protein in Pfam  
PF08213  COX24_C  
Amino Acid Sequences MFRSLVKLVPKFNNGGALVLSRFASSTPTSTFPISHSLMARSSIIGNTTSPIVQQLYMNKLVNFQPTQPKEYNLDTIDEDDDSNTMHALSVLRKRRLKMKKHKYKKRRKAQRALRKRLGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.32
3 0.26
4 0.22
5 0.19
6 0.18
7 0.17
8 0.1
9 0.1
10 0.09
11 0.11
12 0.1
13 0.13
14 0.14
15 0.17
16 0.19
17 0.2
18 0.2
19 0.18
20 0.23
21 0.22
22 0.21
23 0.2
24 0.19
25 0.19
26 0.2
27 0.18
28 0.14
29 0.13
30 0.11
31 0.1
32 0.1
33 0.09
34 0.08
35 0.09
36 0.08
37 0.07
38 0.08
39 0.07
40 0.07
41 0.08
42 0.1
43 0.13
44 0.16
45 0.17
46 0.16
47 0.17
48 0.18
49 0.2
50 0.18
51 0.17
52 0.23
53 0.24
54 0.29
55 0.28
56 0.3
57 0.3
58 0.31
59 0.33
60 0.24
61 0.24
62 0.2
63 0.2
64 0.19
65 0.16
66 0.14
67 0.1
68 0.09
69 0.07
70 0.07
71 0.06
72 0.05
73 0.04
74 0.05
75 0.06
76 0.11
77 0.19
78 0.27
79 0.35
80 0.39
81 0.42
82 0.52
83 0.6
84 0.67
85 0.7
86 0.73
87 0.76
88 0.84
89 0.93
90 0.94
91 0.96
92 0.96
93 0.96
94 0.96
95 0.96
96 0.96
97 0.96
98 0.96
99 0.96
100 0.95