Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C5MAQ8

Protein Details
Accession C5MAQ8    Localization Confidence Low Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
9-28IESRITKKSHSQLKKHQQIDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12, cyto_nucl 9.5, mito 9, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR010920  LSM_dom_sf  
IPR001163  Sm_dom_euk/arc  
Gene Ontology GO:0032991  C:protein-containing complex  
GO:0043170  P:macromolecule metabolic process  
GO:0006807  P:nitrogen compound metabolic process  
GO:0044238  P:primary metabolic process  
KEGG ctp:CTRG_03150  -  
Pfam View protein in Pfam  
PF01423  LSM  
Amino Acid Sequences MNLVLSDTIESRITKKSHSQLKKHQQIDGQEPVYEKRNLGLIILRGEQIVSLSIESNGVISNVKDRIIKQPISRKKKTIV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.31
3 0.38
4 0.46
5 0.54
6 0.61
7 0.66
8 0.76
9 0.82
10 0.76
11 0.71
12 0.65
13 0.61
14 0.58
15 0.54
16 0.44
17 0.35
18 0.33
19 0.31
20 0.31
21 0.27
22 0.2
23 0.14
24 0.15
25 0.14
26 0.13
27 0.13
28 0.11
29 0.12
30 0.13
31 0.12
32 0.1
33 0.1
34 0.09
35 0.08
36 0.07
37 0.05
38 0.05
39 0.05
40 0.06
41 0.06
42 0.06
43 0.06
44 0.05
45 0.05
46 0.06
47 0.06
48 0.09
49 0.1
50 0.12
51 0.14
52 0.16
53 0.25
54 0.31
55 0.36
56 0.4
57 0.5
58 0.59
59 0.67
60 0.73