Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6U702

Protein Details
Accession A0A5N6U702    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
77-97GDSTRRVCRFRTRRHCLSTRLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11, plas 9, E.R. 3, pero 2, vacu 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MPPDQLQVILINSKLRPVLDVDILRIEVFKLRLVDFGEDRLVVRPGIFVIIIIVIVNGRRGLGCWFFVFVFAFFFGGDSTRRVCRFRTRRHCLSTRL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.17
3 0.16
4 0.17
5 0.19
6 0.21
7 0.22
8 0.21
9 0.21
10 0.22
11 0.21
12 0.17
13 0.15
14 0.11
15 0.11
16 0.12
17 0.12
18 0.12
19 0.14
20 0.16
21 0.18
22 0.15
23 0.16
24 0.14
25 0.13
26 0.13
27 0.12
28 0.12
29 0.09
30 0.09
31 0.07
32 0.06
33 0.07
34 0.06
35 0.04
36 0.04
37 0.04
38 0.03
39 0.03
40 0.03
41 0.03
42 0.03
43 0.04
44 0.03
45 0.04
46 0.04
47 0.05
48 0.07
49 0.09
50 0.1
51 0.1
52 0.12
53 0.12
54 0.13
55 0.13
56 0.1
57 0.1
58 0.09
59 0.09
60 0.07
61 0.08
62 0.07
63 0.08
64 0.08
65 0.09
66 0.12
67 0.18
68 0.21
69 0.23
70 0.27
71 0.37
72 0.47
73 0.56
74 0.64
75 0.68
76 0.75
77 0.82