Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N6TZ87

Protein Details
Accession A0A5N6TZ87    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
64-86SYTVPIQRKEREKKTWRRLKESGHydrophilic
NLS Segment(s)
PositionSequence
71-97RKEREKKTWRRLKESGASEDKKVKRSR
Subcellular Location(s) mito_nucl 13.666, mito 13, nucl 12, cyto_nucl 8.166
Family & Domain DBs
Amino Acid Sequences MIPSAVFNSSRHAKIKILNSTNCHNRVLIHLRKPYNPLSLVQNSAFFEGPKIINILTGGFGDQSYTVPIQRKEREKKTWRRLKESGASEDKKVKRSRFTPKALATLTASRYFL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.46
3 0.49
4 0.51
5 0.52
6 0.53
7 0.58
8 0.63
9 0.59
10 0.52
11 0.42
12 0.35
13 0.37
14 0.42
15 0.42
16 0.41
17 0.46
18 0.48
19 0.51
20 0.54
21 0.5
22 0.46
23 0.4
24 0.34
25 0.33
26 0.32
27 0.32
28 0.28
29 0.27
30 0.23
31 0.23
32 0.21
33 0.14
34 0.12
35 0.12
36 0.11
37 0.09
38 0.09
39 0.07
40 0.08
41 0.08
42 0.07
43 0.06
44 0.06
45 0.05
46 0.05
47 0.05
48 0.05
49 0.05
50 0.05
51 0.05
52 0.06
53 0.08
54 0.12
55 0.15
56 0.22
57 0.29
58 0.38
59 0.46
60 0.54
61 0.62
62 0.69
63 0.77
64 0.81
65 0.85
66 0.82
67 0.82
68 0.79
69 0.76
70 0.74
71 0.69
72 0.66
73 0.66
74 0.61
75 0.55
76 0.6
77 0.56
78 0.55
79 0.57
80 0.54
81 0.54
82 0.6
83 0.68
84 0.68
85 0.72
86 0.74
87 0.71
88 0.73
89 0.65
90 0.6
91 0.53
92 0.49
93 0.45