Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6TK95

Protein Details
Accession A0A5N6TK95   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MRKRWEIKWSRPNRRENLHIKRABasic
NLS Segment(s)
Subcellular Location(s) mito 13, plas 7, cyto 3.5, cyto_nucl 2.5, E.R. 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MRKRWEIKWSRPNRRENLHIKRALAVVSVGGLTCLSQSASFWDIESSGRSNGIVDYIFSTVCSWVSVDYMHLTLSLAIFFSSQIMLSLM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.82
3 0.81
4 0.8
5 0.79
6 0.74
7 0.65
8 0.59
9 0.53
10 0.44
11 0.34
12 0.23
13 0.13
14 0.1
15 0.09
16 0.06
17 0.05
18 0.04
19 0.04
20 0.04
21 0.04
22 0.04
23 0.04
24 0.04
25 0.06
26 0.08
27 0.08
28 0.08
29 0.08
30 0.08
31 0.09
32 0.1
33 0.09
34 0.08
35 0.08
36 0.08
37 0.08
38 0.07
39 0.08
40 0.06
41 0.05
42 0.07
43 0.07
44 0.07
45 0.07
46 0.08
47 0.07
48 0.07
49 0.07
50 0.06
51 0.06
52 0.07
53 0.07
54 0.07
55 0.09
56 0.09
57 0.08
58 0.08
59 0.08
60 0.08
61 0.08
62 0.07
63 0.06
64 0.06
65 0.06
66 0.06
67 0.06
68 0.06
69 0.06