Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q755Y5

Protein Details
Accession Q755Y5   
Localization Confidence Medium
Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
23-50GMCARRLHKSPRTRKGKVSKTPPKVFCVHydrophilic
NLS Segment(s)
PositionSequence
28-42RLHKSPRTRKGKVSK
Subcellular Location(s) cyto_nucl 14.5, cyto 12.5, nucl 9.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002068  A-crystallin/Hsp20_dom  
IPR008978  HSP20-like_chaperone  
IPR031107  Small_HSP  
Gene Ontology GO:0043621  F:protein self-association  
GO:0051082  F:unfolded protein binding  
GO:0051259  P:protein complex oligomerization  
GO:0006457  P:protein folding  
GO:0009408  P:response to heat  
GO:0042542  P:response to hydrogen peroxide  
GO:0009651  P:response to salt stress  
KEGG ago:AGOS_AER382W  -  
Pfam View protein in Pfam  
PF00011  HSP20  
PROSITE View protein in PROSITE  
PS01031  SHSP  
CDD cd06464  ACD_sHsps-like  
Amino Acid Sequences MSSYPIFIGSELLGDARAALHAGMCARRLHKSPRTRKGKVSKTPPKVFCVKPPIDIVERDGTYLAHIANPGVANQDDIKVEYHEDRNTVIISGSLPVMAGQRQGDKCHIKELPSGNFCREIDFPEHEAIDASKISLDYEHGILSISIPKLPVRRAATVQKIKIRG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.05
4 0.05
5 0.05
6 0.05
7 0.05
8 0.06
9 0.09
10 0.1
11 0.12
12 0.15
13 0.17
14 0.21
15 0.26
16 0.34
17 0.41
18 0.5
19 0.59
20 0.67
21 0.75
22 0.75
23 0.8
24 0.82
25 0.83
26 0.82
27 0.82
28 0.82
29 0.82
30 0.87
31 0.8
32 0.75
33 0.72
34 0.64
35 0.61
36 0.6
37 0.51
38 0.45
39 0.44
40 0.42
41 0.37
42 0.36
43 0.31
44 0.26
45 0.25
46 0.22
47 0.2
48 0.16
49 0.14
50 0.14
51 0.11
52 0.06
53 0.06
54 0.06
55 0.07
56 0.07
57 0.06
58 0.07
59 0.07
60 0.07
61 0.07
62 0.09
63 0.08
64 0.08
65 0.09
66 0.08
67 0.09
68 0.1
69 0.12
70 0.12
71 0.12
72 0.12
73 0.12
74 0.12
75 0.11
76 0.09
77 0.06
78 0.06
79 0.06
80 0.05
81 0.04
82 0.04
83 0.04
84 0.05
85 0.05
86 0.06
87 0.07
88 0.12
89 0.14
90 0.16
91 0.22
92 0.26
93 0.26
94 0.31
95 0.32
96 0.28
97 0.32
98 0.36
99 0.38
100 0.38
101 0.39
102 0.35
103 0.38
104 0.36
105 0.34
106 0.29
107 0.25
108 0.24
109 0.26
110 0.27
111 0.24
112 0.24
113 0.21
114 0.21
115 0.18
116 0.15
117 0.11
118 0.09
119 0.08
120 0.08
121 0.08
122 0.08
123 0.09
124 0.09
125 0.1
126 0.1
127 0.09
128 0.1
129 0.09
130 0.1
131 0.14
132 0.12
133 0.12
134 0.13
135 0.17
136 0.2
137 0.23
138 0.3
139 0.31
140 0.35
141 0.41
142 0.49
143 0.57
144 0.62
145 0.67