Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6TDF0

Protein Details
Accession A0A5N6TDF0    Localization Confidence Low Confidence Score 5.5
NoLS Segment(s)
PositionSequenceProtein Nature
54-79SGHFYHCAKNEKKRKTQKDYHGLLFPHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 7, mito 5, E.R. 5, extr 3, golg 3, cyto_nucl 2, nucl 1.5, cyto 1.5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MLVAGSTPVDDLHVYFLCCMPFSCIRYLAAFSFPFSLFLVISHISFVTCIHYRSGHFYHCAKNEKKRKTQKDYHGLLFPMSPR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.13
3 0.14
4 0.13
5 0.13
6 0.13
7 0.14
8 0.17
9 0.19
10 0.21
11 0.21
12 0.22
13 0.22
14 0.24
15 0.2
16 0.19
17 0.17
18 0.15
19 0.16
20 0.15
21 0.15
22 0.13
23 0.13
24 0.09
25 0.09
26 0.1
27 0.08
28 0.08
29 0.07
30 0.07
31 0.06
32 0.06
33 0.06
34 0.08
35 0.09
36 0.1
37 0.11
38 0.13
39 0.14
40 0.2
41 0.22
42 0.2
43 0.24
44 0.26
45 0.32
46 0.37
47 0.45
48 0.45
49 0.53
50 0.6
51 0.66
52 0.73
53 0.78
54 0.82
55 0.83
56 0.88
57 0.88
58 0.89
59 0.86
60 0.8
61 0.75
62 0.65
63 0.56