Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C5M269

Protein Details
Accession C5M269   
Localization Confidence Medium
Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
46-68PSIPPERKRKDKMLPKSTRKEIEBasic
NLS Segment(s)
PositionSequence
52-57RKRKDK
Subcellular Location(s) nucl 16, cyto_nucl 10.333, mito 4.5, cyto_mito 4.166, cyto 2.5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG ctp:CTRG_00158  -  
Amino Acid Sequences MYLITQKFYTPIDRFINKFRRKGFLLYTGIILFSVGYIFYSISNLPSIPPERKRKDKMLPKSTRKEIEEEEEVDLGPTDAAIPLEQTNSNDHVINKWSKRKLFEFLFNEKIYPDVDEDLNLVKKQVIEIFEFKKENGTLEEKYISEL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.5
3 0.59
4 0.58
5 0.63
6 0.6
7 0.59
8 0.57
9 0.6
10 0.55
11 0.53
12 0.5
13 0.44
14 0.42
15 0.35
16 0.31
17 0.26
18 0.2
19 0.11
20 0.07
21 0.06
22 0.04
23 0.04
24 0.04
25 0.04
26 0.05
27 0.06
28 0.06
29 0.07
30 0.08
31 0.08
32 0.08
33 0.11
34 0.15
35 0.2
36 0.28
37 0.37
38 0.44
39 0.53
40 0.59
41 0.63
42 0.7
43 0.74
44 0.76
45 0.77
46 0.8
47 0.8
48 0.82
49 0.8
50 0.76
51 0.67
52 0.6
53 0.51
54 0.45
55 0.38
56 0.32
57 0.27
58 0.21
59 0.19
60 0.15
61 0.13
62 0.08
63 0.05
64 0.04
65 0.03
66 0.03
67 0.03
68 0.03
69 0.04
70 0.04
71 0.06
72 0.06
73 0.07
74 0.09
75 0.12
76 0.13
77 0.14
78 0.14
79 0.14
80 0.18
81 0.24
82 0.28
83 0.33
84 0.38
85 0.4
86 0.45
87 0.47
88 0.5
89 0.48
90 0.52
91 0.5
92 0.51
93 0.53
94 0.48
95 0.45
96 0.38
97 0.34
98 0.25
99 0.2
100 0.15
101 0.11
102 0.11
103 0.11
104 0.12
105 0.15
106 0.17
107 0.16
108 0.15
109 0.14
110 0.14
111 0.15
112 0.18
113 0.17
114 0.18
115 0.24
116 0.28
117 0.32
118 0.33
119 0.32
120 0.34
121 0.32
122 0.3
123 0.29
124 0.31
125 0.26
126 0.29
127 0.32