Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N6TJ64

Protein Details
Accession A0A5N6TJ64    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MKGTKKKENKKRTALSIPIIHydrophilic
NLS Segment(s)
PositionSequence
6-8KKE
Subcellular Location(s) mito 20, nucl 3, cyto 2, plas 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MKGTKKKENKKRTALSIPIIQILTQNIYLLSLTYLPLSLHTYSFFHTLSNILYHVRFSFCTLYQWMDFRGLAFIEAFPFFFFYYRPSFFLFPMYNIPGPFVCMRERECVCA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.75
3 0.7
4 0.61
5 0.53
6 0.45
7 0.36
8 0.28
9 0.23
10 0.2
11 0.14
12 0.12
13 0.09
14 0.09
15 0.09
16 0.08
17 0.07
18 0.06
19 0.06
20 0.06
21 0.06
22 0.06
23 0.07
24 0.1
25 0.1
26 0.1
27 0.11
28 0.11
29 0.12
30 0.15
31 0.13
32 0.11
33 0.1
34 0.11
35 0.1
36 0.1
37 0.09
38 0.08
39 0.08
40 0.08
41 0.09
42 0.09
43 0.08
44 0.1
45 0.11
46 0.11
47 0.13
48 0.13
49 0.15
50 0.15
51 0.15
52 0.14
53 0.14
54 0.13
55 0.11
56 0.11
57 0.09
58 0.09
59 0.08
60 0.07
61 0.07
62 0.07
63 0.07
64 0.06
65 0.08
66 0.08
67 0.08
68 0.08
69 0.1
70 0.15
71 0.17
72 0.19
73 0.21
74 0.23
75 0.23
76 0.29
77 0.27
78 0.23
79 0.26
80 0.29
81 0.28
82 0.26
83 0.28
84 0.22
85 0.24
86 0.23
87 0.21
88 0.19
89 0.21
90 0.24
91 0.3